KEGG   Medicago truncatula (barrel medic): MTR_3g096910Help
Entry
MTR_3g096910      CDS       T01716                                 

Definition
(RefSeq) beta-galactosidase-like protein
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 GHD Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 11424010
NCBI-ProteinID: XP_003602682
UniProt: G7JC84
Position
3
AA seq 719 aa AA seqDB search
MEKWVCLMMMLVAILELSFGVKGAEEVTYDGRSLIINGQRNILFSGSIHYPRSTPQMWPG
LIAKAKQGGLDVIQTYVFWNLHEPQPGKYDFSGRNDLVGFIKEIHAQGLYVSLRIGPFIE
SEWNYGGFPFWLHDVPGIVYRTDNEPFKFYMQNFTTKIVNMMKEEGLYASQGGPIILSQI
ENEYGNIQKAFGTAGSQYVEWAAKMAVGLNTGVPWVMCKQPDAPDPVINTCNGMRCGETF
TGPNSPNKPAMWTENWTSFYQVYGGVPYIRSAEDIAFHVTLFVARNGSFVNYYMYHGGTN
FGRTSSAYMITGYYDQAPLDEYGLFRQPKWGHLKELHAAIKSCSTTLLQGVQRNFSLGEL
QEGYVFEEENGKCAAFLINNDKGNTVTVQFNNSSYKLLPKSISILPDCQNVAFNTAHLNT
TSNRRIITSRQNFSSVDDWKQFQDVIPNFDDTSLRSDSLLEQMNTTKDKSDYLWYTLRLE
NNLSCNDPILHVQSSAHVAYAFVNNTYIGGEHGNHDVKSFTLELPITLNERTNNISILSG
MVGLPDSGAFLEKRFAGLNNVELQCSEQESLNLNNSTWGYQVGLLGEQLKVYTEQNSTDI
KWTQLGNITIDEVTLTWYKTTFDTPKGDDPIALDLSSMAKGEAWVNGQSIGRYWILFLDS
KGNPSQSLYHVPRSFLKDSENSLVLLDEGGGNPLDISLNTVSVTDLQDNFSKLPFPTYT
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatgggtgtgtttgatgatgatgttggtagcaatattggaattaagttttgga
gtcaaaggtgcagaagaggtaacatatgatggaagatctcttatcatcaatggacaaaga
aatattctcttctctggttctattcattacccccgtagcacccctcagatgtggccaggt
ttgatagcgaaagcaaaacaaggaggattggatgttattcaaacttatgtgttttggaat
ctacatgaaccccaacccggcaagtatgatttcagcggcagaaatgacttggtgggattc
ataaaggaaatccatgctcaaggattgtacgtttccctcaggattggacctttcatcgag
agtgaatggaattacgggggattcccattttggctacatgatgtccctggtattgtctac
cgaacagacaatgagccattcaagttctacatgcaaaattttacaacaaaaatcgtgaac
atgatgaaagaagagggtttatatgcttcgcaaggaggcccaattatattgtcacagatt
gagaatgaatatggaaatatccaaaaggcatttggaactgcaggatcgcagtatgttgaa
tgggctgcaaaaatggcagtgggtcttaatacaggcgtaccatgggttatgtgcaagcaa
cccgatgctcctgatcctgtgatcaatacatgcaatggcatgagatgtggagaaactttt
actggaccaaactcccccaataagcctgccatgtggacagagaattggacatctttctat
caagtatacggtggagtgccatatatacgctctgctgaagacattgcatttcatgtcact
ctttttgttgcaagaaatggaagctttgtcaactactatatgtatcatggtggaactaac
tttgggagaacaagctctgcttatatgataacaggctattatgatcaagcaccacttgat
gaatatggtttattcaggcaacctaagtggggacatctcaaggagttgcatgctgcaatc
aagtcttgttccaccactttattacaaggagtgcaaagaaacttttctttaggtgaactt
caagagggttatgtttttgaagaagaaaatggaaaatgtgctgcatttcttataaacaat
gataaagggaacactgttacagtccaattcaacaatagttcgtacaagttgctcccaaag
tctataagtatcttaccagattgtcaaaatgtggctttcaataccgcacatttaaataca
acgagcaacagaaggatcataacttcaagacaaaacttcagctcagttgatgattggaaa
caattccaagatgtcattccaaactttgatgacacttcactaagatcagactcattactt
gagcaaatgaatacaaccaaagacaaatctgattacctttggtatactcttaggcttgaa
aataatttatcttgcaacgatccaatactccatgttcaatcttctgctcatgttgcctat
gcttttgtgaacaatacatacattggaggggaacacggaaatcatgatgtgaagtcattt
acattagagctcccaattacattaaacgaaagaacgaacaatatttctattctcagcggt
atggttggacttccggattcaggggcatttcttgaaaaaagatttgctggtttaaacaat
gtggaacttcagtgcagtgaacaagagtctcttaatttgaacaattctacatggggatat
caggttggattacttggagagcaattaaaagtatatacagaacaaaatagcacagacatt
aaatggactcaattggggaatatcacgattgatgaagttactctcacttggtacaagact
acatttgacacacccaagggagatgaccccattgccttagaccttagctcaatggcaaaa
ggtgaagcttgggtaaatggacaaagcattggtcgctattggattttgtttcttgattcc
aaaggcaatccttcacaatcattgtatcatgttcctcggtctttccttaaagatagtgaa
aacagtttggtattgctggatgaaggtggtgggaaccctcttgatatctccttgaacact
gtttcagtcacagatttacaagataacttttctaaattgccattccctacctatacttaa

DBGET integrated database retrieval system