KEGG   Medicago truncatula (barrel medic): MTR_3g106560Help
Entry
MTR_3g106560      CDS       T01716                                 

Definition
(RefSeq) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MTR_3g106560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtr01007]
    MTR_3g106560
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtr03016]
    MTR_3g106560
Enzymes [BR:mtr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     MTR_3g106560
Amino acid related enzymes [BR:mtr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MTR_3g106560
Transfer RNA biogenesis [BR:mtr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MTR_3g106560
 Prokaryotic Type
    MTR_3g106560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 11432999
NCBI-ProteinID: XP_003603345
UniProt: G7JAF7
Position
3
AA seq 570 aa AA seqDB search
MGTLTLSLLKHYTPFSTTLFTHSSRTLSPGHLSAVFRRKNLPSFRAISSSSQPLTAEKNS
HDGGENSRSKSPSPEVWLHNTMSKKKELFKPKVEKKVGMYVCGVTAYDLSHIGHARVYVN
FDLLYRYFKHLGFQVCYVRNFTDVDDKIIARSKELGEDPISLSRRYCEEFCQDMVTLNCL
PATVEPKVSEHMPQIIEMIEKILNNGYAYDVDGDIYFNVEKFPEYGKLSSRGLEDNRAGE
RVAVDSRKKNPADFALWKSTKPGEPFWESPWGPGRPGWHIECSAMSAAYLGYSFDIHGGG
IDLVFPHHENEIAQSCAACSKSDISVWMHNGFVTIDSVKMSKSLGNFFTIRQVVDVYHPL
ALRYFLMSAHYRSPMNYSNIHLESASDRVFYIYETLHECESFLKQHDQTVRKDSVPPDTL
SIIGNFYDVFRTSMSDDLHTPVALAGMSDPLKLINDLLHTRKGKKQQFRIESLAALKKSI
GDVLTVLGLMPSSYYEVLQQLKEKALNRANLTEDEILKKIEERDAARIQKEYAKSDSIRK
GLAVLGIALMDSPNGTTWRPTIPLPLQEQL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggtacccttaccctgtctcttctgaaacactacacgccattttccaccacactcttc
acccactcatctcgaacgctttcccccggtcacctttccgccgtattccgaagaaagaat
cttccttccttccgcgccatctcatcttcctctcagccgttaactgcggagaaaaattcc
cacgacggtggtgaaaattcccgctcaaagagtccttcgccggaagtatggctccacaac
acaatgagtaaaaagaaagagctttttaaacccaaagtggaaaagaaagttggaatgtat
gtttgtggtgttactgcttatgatcttagccatattggtcatgctcgtgtttacgtcaat
ttcgatcttctttacagatattttaagcacttgggatttcaagtttgttatgttcgcaat
tttactgatgtagatgacaagataattgctagatcgaaggagttaggagaagatccaatc
agtttgagtcgacgctattgtgaagagttctgtcaagacatggtaactcttaattgtttg
cctgctaccgtggaaccgaaagtgtctgagcacatgccccaaatcattgaaatgattgag
aagattcttaataatgggtatgcatacgatgttgatggggatatatactttaatgtagaa
aaatttccagaatatgggaaattatcaagtcgaggtctagaagataatcgagctggtgag
agggttgctgttgattcaaggaagaaaaatcctgctgattttgctctttggaagtctaca
aaaccaggggagccattttgggagagtccctggggtcctggaagacctgggtggcatatt
gaatgcagtgctatgagtgcagcttatcttggttactcttttgacatccacggtggaggg
attgaccttgtatttcctcaccatgaaaatgaaattgctcagagttgtgctgcttgtagt
aaaagtgatattagtgtttggatgcacaatggttttgtcaccattgactcggtgaagatg
tctaaatctctgggaaactttttcacaatacggcaggttgtagatgtttaccatccgttg
gctttgagatattttttgatgagtgctcattatagatctcccatgaactactctaatata
caccttgaaagtgcttcagaccgtgttttttatatatacgagacattacacgaatgtgaa
agctttctgaagcagcatgatcagacagttaggaaggattccgtcccaccagatacgttg
agtattatcggtaacttctatgatgtttttcggacctcaatgtctgatgatcttcacact
ccagttgcattggccggaatgtctgacccactaaaattaattaacgacttgctgcatact
cgcaagggaaaaaaacagcaatttcgaatagaatcacttgcagctttgaagaaaagcatt
ggggatgtccttactgttttaggtctcatgccttcaagttattatgaggttttacagcag
cttaaggagaaagctcttaatcgtgcaaacctgacagaagatgaaatcttgaagaagatc
gaagaacgggatgctgctagaatacaaaaggagtatgccaaatccgattccataaggaaa
ggtttggctgttcttggtattgctcttatggatagtccgaatggcacaacttggaggcct
accattcctcttccgcttcaagaacaactctag

DBGET integrated database retrieval system