KEGG   Medicago truncatula (barrel medic): MTR_3g110640Help
Entry
MTR_3g110640      CDS       T01716                                 

Definition
(RefSeq) 50S ribosomal protein
  KO
K19035  50S ribosomal protein 6
Organism
mtr  Medicago truncatula (barrel medic)
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mtr03011]
    MTR_3g110640
Ribosome [BR:mtr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MTR_3g110640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5323
Motif
Other DBs
NCBI-GeneID: 11436654
NCBI-ProteinID: XP_003603663
UniProt: B7FHD4
Position
3
AA seq 104 aa AA seqDB search
MSSVSSIFGCGVSIAPNSLRKKAIGIERRNVCGGLLIECSSRPQKKSTAHHMKTRPRKSS
LSDRNRKPTEYAPLPPLPPDFTIVIPADASSTATVVPPPPTPST
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggtgtcaagcatattcggatgcggggtttcgattgcgccaaattcattgaga
aagaaagcaattggaattgaaaggagaaatgtttgtggaggattgttgatagagtgttca
tcgaggccacagaagaaatcaactgcacatcacatgaagacgagacccagaaaatcatca
ctgtcggataggaatcggaaaccaacagagtatgctccgttgccaccactgcctcctgat
tttacaattgtcattcctgctgatgcatcttcaacggctactgttgttcctccgcctcct
actccttctacttga

DBGET integrated database retrieval system