KEGG   Medicago truncatula (barrel medic): MTR_4g076720Help
Entry
MTR_4g076720      CDS       T01716                                 

Definition
(GenBank) serine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00340  Histidine metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    MTR_4g076720
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     MTR_4g076720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AES89540
UniProt: G7JQN8
Position
4
AA seq 301 aa AA seqDB search
MSTYYRDTVESLEGSNMTMAIIPDAEMLPTVVGIAKLSEEERHANIHEEDINRLTNIAIT
QCIGETDANLDAVIAHYVETINKYNLCNLGYPGNQDFNYEALAPLLQFLLNNAGDPFLGS
GFSLNSMTFEVSVLDWFAKLWEIEKDQYWGYVTTGGTEGNLHAILVAREQFPDGILYTSQ
DSHYSIFKIARMYRMQCVKVGSLLSGEIDCVELEASLLSHKDKPAIINLNIGTTLKGGID
DLDLVIQTLDKCGFTRDQFYIHCDGALFGIMLPFIQQVQRIIYVKRIMYLRGLCTREDDV
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtccacatattacagggatacagtggagagcttagaaggaagcaacatgacaatggct
atcattcctgatgcagagatgttgccaacagttgttggcattgccaaactctcagaagaa
gagagacatgcaaatattcatgaagaggacattaatagacttaccaacattgctatcaca
caatgcattggtgaaactgatgccaatttagatgcagtaattgctcactatgtggagact
ataaacaaatacaacttgtgtaacttaggttatcccggaaatcaagacttcaactatgaa
gcattagcaccgttacttcaatttctcttgaacaatgctggagatccatttcttggaagc
ggcttttctctcaattcaatgacatttgaagttagtgtgcttgattggtttgctaaacta
tgggagatagagaaggatcagtactggggatacgtcacaactggtggaacggaagggaat
cttcatgcgattttagtagcgagagaacaatttccagatggaattctatatacctcacaa
gattcacattattcgatattcaaaattgcaagaatgtatcgaatgcaatgtgtgaaggtt
ggctctttattatcaggtgaaattgattgtgttgaactagaggcttctctactttcccac
aaggataaaccagccatcatcaatctaaacatagggacaactttgaaaggtgggattgat
gatcttgatcttgtaatacaaacactagacaaatgtggttttactcgtgatcaattctac
attcattgtgatggagctttatttggaatcatgttgccttttatccaacaagtacaaagg
attatatatgtcaaaaggataatgtaccttagagggttatgtacccgagaggatgatgta
ccctag

DBGET integrated database retrieval system