KEGG   Medicago truncatula (barrel medic): MTR_4g105610Help
Entry
MTR_4g105610      CDS       T01716                                 

Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
mtr  Medicago truncatula (barrel medic)
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MTR_4g105610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-ProteinID: KEH31833
UniProt: A0A072URZ9
Position
4
AA seq 266 aa AA seqDB search
MQSLSLSSTKSLAGLRLMSQEARVKRRGGNSNNMVVACGNNSDKDTAPSSTSFLSRTQTY
ALLKQQMEVAAKSEDYKEAARIRDSLKLFEEEEPVLRLRRLIKEAIADERFQDAASYRDE
LKRIAPHSFLKCSSDATTLGVRVQVRSVYIEGRSQPSKGLYFFAYRIRITNNSDDTVQLL
RRHWIITDANGRSENVRGIGVVGEQPVLLPRTSFEYSSACPLSTPNGRMEGEYEMIHVDK
VGSPSFNAIIAPFSLALLGDDDCNTI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgttatcattaagcagtacgaagagtttggcgggtttgcggttgatgagtcaa
gaagcgagagtgaagagaaggggtggcaatagcaataacatggtggtggcatgtggtaat
aattcggataaagatactgctccaagttcaacctcatttctatctcggactcaaacatat
gctcttttgaaacaacaaatggaagtagctgctaaatccgaggattacaaggaagctgct
agaattcgagattcacttaagttatttgaagaagaggaacctgttttgcgtttaaggagg
ctaattaaggaagcaattgctgatgagagattccaggatgcagctagttatcgtgatgag
ctaaaaagaattgctccacactcttttttaaaatgttccagtgatgctacaacactggga
gtcagggttcaagtcaggagtgtatatatagagggaagaagtcagccttcgaaggggcta
tacttttttgcatatagaataagaattaccaataactcagatgacaccgttcaacttctt
agaaggcactggatcataaccgatgccaacgggagatcagaaaatgtacgggggattgga
gttgttggtgaacagccagtacttcttcccagaactagttttgagtactcctctgcatgc
ccattaagcacaccaaatggtagaatggaaggtgaatatgagatgatccatgttgataaa
gtaggttcaccttcatttaatgcgatcattgccccattttctctcgctctgcttggagat
gatgactgcaataccatttga

DBGET integrated database retrieval system