KEGG   Medicago truncatula (barrel medic): MTR_4g132620Help
Entry
MTR_4g132620      CDS       T01716                                 

Definition
(GenBank) subtilisin-like serine protease
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 Inhibitor_I9 fn3_6 Sarcoglycan_2
Motif
Other DBs
NCBI-ProteinID: AES92673
UniProt: G7JKE6
Position
4
AA seq 820 aa AA seqDB search
MTKILSSIALPSLITFILIFLISITCCFQEERSIYLVLLEGEAVAFHGASQNEDSSKIHL
IRGASKAHEKYLLASHDMLLQSTLENGSYNKLHSYKHIINGFSVHTTPSQAKRLRATPGV
KLVEKDRGVKLMTTYTPDFLNLPKGLWAQVGGDKNAGDGIVIGIVDSGINPIHPSFAYQP
FTSNISHFSGACETGPHFPPGSCNGKIISAKYFSAGAQASPTFDASVDFLSPFDAGGHGS
HVASIAAGNAGVPVVVNGFFYGQASGMAPRARIAVYKAIYPSGGTMADAVAAIEQAVQDG
VDIISLSIGPNEPTKDTLTFLNIFDITLLFARKAGVLVVQAAGNNGPSSSTVVSFSPWSV
GVAACNTDRHYYSSILLRNGTIVGGVGLTGPSFGNGKVYHTLVLAKDAVKINGTFPRTPE
YLEECQHPEALDPSKVFGSIIICTFSEGFLNQTSTLAAIIDTAKALKFEGFIFTANPSYG
DYIAEPIPFGIPGILIPSVADSKVIMQYYEEHTKRDERGTVTEFGAAASTGEGRDASFKG
RSPVVSRFSSRGPDIIDSKRTLADVLKPDILAPGHQIWAAWSPISAKQPMLTGHNFALLS
GTSMAAPHVAGIAALIKQHNPSWTPSMIASAITTTSRKYDKLGDPLMAEGYEANTLHPST
PFEHGAGIVDPSRVNNPGLVLSSDYEDFISFLCSLPNIDTKTITRATGETCNSPFDYPSN
LNLPSVTISALKGSIYLKRTVMNVGNSTETYLCGVRAPNRTAVNLYPTFFTITPQGTQDL
EIQINVTQPSEDFSFGEIVLAGSMNHIVRITLSVVPVSTQ
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatattgagttctatagctttaccatccctcatcactttcattttgatcttc
ttgatttctattacttgttgctttcaagaggagcgatctatatacttggtcttattggaa
ggagaagcggttgcatttcatggagcttcacaaaatgaagattcatcaaagattcacctc
atcagaggagcctcgaaggcacatgaaaaatacttattagcgtctcatgacatgcttcta
caaagcactttggagaatggaagttataataaactccacagttataaacacataattaat
ggcttctctgttcacacaaccccttcccaggcaaaaagactaagagctacaccaggagtg
aagttagtagagaaagatagaggagtgaaactgatgacaacatacactcctgattttctt
aacttgccaaaaggattatgggcacaagtaggaggtgacaaaaatgcaggtgatggaatt
gttattggtattgttgatagtggcattaatccaattcatccaagctttgcttaccaacct
ttcacttcaaatatctctcacttttctggtgcttgtgagactggtccacatttcccacct
ggttcttgcaatggaaagattatttcagctaaatatttctctgctggtgctcaagctagt
cctacctttgatgcttctgtggattttctttcaccttttgatgcaggtggacatggaagt
catgtggcatctattgctgctggaaatgctggtgttcctgttgtagtgaatggttttttc
tatgggcaagcgagcggaatggcaccgcgtgcaaggattgccgtttataaggctatctac
ccatccgggggaactatggcagatgctgttgcagctattgaacaagctgtccaagatgga
gtagatatcatatcactctctattggaccaaatgaaccaacaaaagatacattgacattt
ctcaacatctttgatattaccttattatttgcaagaaaagcaggggttttagtggtgcaa
gctgcagggaataatggtccatcatcttcaactgtagtgtcatttagtccatggagtgtc
ggtgttgccgcttgcaacacagacagacattattattcttcaattcttcttagaaatggc
acaatagttggtggtgttggactaacaggaccaagttttgggaatgggaaggtttaccat
acacttgtattagctaaggatgcagtgaaaataaatggaacatttccaaggactccagag
tacttagaagagtgtcaacatccagaagctttggatcctagtaaagtgtttggaagtatc
attatatgcaccttctcagaaggatttcttaatcagacctcaactcttgctgccattatc
gacactgccaaggctctaaaattcgagggttttatttttactgcaaatccgagctatggc
gattatattgcagagccaattcctttcggtattcccggtatcttgattccttctgtcgcg
gattccaaggttataatgcaatattatgaagaacatacaaagagggacgagagaggaact
gttacagagtttggtgctgcggcatctacgggggaaggaagggatgcctctttcaaaggg
cgatcaccggttgttagtagattttcttcaaggggtccagatataattgattcaaaaaga
actcttgctgatgtacttaaacctgatattcttgctccagggcaccaaatatgggccgca
tggagtcctattagtgccaaacaacctatgctaacaggacacaattttgcattattatcc
ggtaccagcatggcggcgcctcatgtggctggaatcgcagcactgatcaagcaacataat
ccatcatggactccatctatgatagcatctgcgatcaccacaaccagcagaaagtatgac
aagcttggagatcctctgatggccgaaggctacgaggccaacaccttgcatccctccact
ccttttgaacatggtgcgggcattgtggaccctagccgtgtcaataatccaggcttggtt
ctatcttcagattatgaagacttcatcagcttcctgtgctctttgccaaacattgatacg
aagacaataactagagcgacgggagagacctgcaacagcccatttgactatccatctaat
ttaaaccttccatcagtgacaatatctgcacttaaaggatcaatttatttgaaaagaact
gtcatgaatgtagggaacagcacagagacatacttatgcggtgttcgagctcctaataga
actgcagttaacctgtatccaactttttttaccataactccacaaggaactcaggatctg
gaaatacaaatcaatgtcactcaaccaagtgaagattttagctttggtgaaattgttttg
gcaggaagtatgaaccacatagtaagaataactttgtcagttgtgccagtttcaacacaa
tga

DBGET integrated database retrieval system