KEGG   Medicago truncatula (barrel medic): MTR_5g010030Help
Entry
MTR_5g010030      CDS       T01716                                 

Definition
(RefSeq) MAP kinase
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 11435704
NCBI-ProteinID: XP_003611065
UniProt: G7KC07
Position
5
AA seq 375 aa AA seqDB search
MGSKSQDNNDRDLVKKVFTHKGRYVQYSLYGNLFEVSSKYVPPLRPIGRGAYGIVCAAVN
SDTHEEVAIKKIANTFDNIIDAKRTLREIKLLRHMDHENIIAIKDIIRPPQKDNFNDVYI
VYELMDTDLHQIIRSNQPLNPDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNGNCD
LKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTSAIDVWSVGCIFAEIMTREP
LFPGKDYVHQLRLITELIGSPDDSSLRFLRSENARKYLRQLPQFGKQNLSVKFPSMSAEP
LNLLEKMLVFDPVKRITVDEALCHPYLSSLHDINDEPVPPTPFSFDFEQPGCTQEHIKEL
IWRESVNFNPDPPSQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaaaagccaagataataatgatagagatttagtaaagaaggttttcactcac
aaaggtcgatacgtgcaatacagtttgtatggaaacttgtttgaagtgtcctccaaatat
gttcctcctcttcgccctatcggtagaggtgcttatggaatcgtctgtgctgctgttaat
tctgatacacatgaggaagttgccatcaagaagattgccaatacatttgacaacattatt
gatgctaaaaggactttgagggaaattaagcttcttcgtcacatggaccatgaaaatatt
attgctattaaggatattatacgacctccacaaaaggataattttaatgatgtttacatt
gtttatgaattgatggacactgatcttcatcagattattcgttctaatcaacctctcaac
ccagaccattgtcagtactttctatatcagctgttaaggggactgaaatatgtgcattcg
gcaaatgtcttgcaccgtgaccttaaaccaagtaatttacttttgaatggaaactgtgac
cttaaaattggggactttggtttggcaaggacaacatccgaaacagattttatgacggag
tatgtcgttactagatggtacagagccccagaattgctccttaattgttcagagtacaca
tctgcaattgatgtctggtctgttggttgcatatttgctgaaattatgaccagagaaccc
ttgtttcctgggaaggattatgttcatcaactaaggcttataaccgagttgataggttca
cctgacgattcgagcctcagatttctacgaagtgaaaatgccagaaagtatcttagacag
cttccacagtttgggaagcaaaacctttcggtgaaatttcctagtatgtcggctgagcct
ctgaacttgctagaaaaaatgcttgtatttgatcctgttaaacgaattacagtggatgag
gcactatgtcacccatatctttcatcacttcatgacatcaatgatgaaccagttcctcct
acgccattcagttttgattttgagcagccaggatgtactcaagagcacattaaggagctc
atctggagggaatcagtgaatttcaatcccgatccaccgtctcagtaa

DBGET integrated database retrieval system