KEGG   Medicago truncatula (barrel medic): MTR_5g046610Help
Entry
MTR_5g046610      CDS       T01716                                 

Definition
(RefSeq) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_5g046610
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     MTR_5g046610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 11436410
NCBI-ProteinID: XP_003614223
UniProt: G7JX01
Position
5
AA seq 607 aa AA seqDB search
MDTNLGSLEACKSPCNDIITTPSSNGTVSTIQKSPSTQSLASSESTLGSHLARRLVEVGI
TDIFTVPGDFNLTLLDHLIAEPKLKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGL
SVINAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQELRCFQTVTCYQAVV
NNLEDAHEMIDTAISTALKESKPVYISISCNLASIPHPTFSHEPVPFSLSPKLSNPMGLE
AAVEAAAEFLNKAVKPVLVAGPKLRVAKACEAFIELADKSAYPYSVMPSAKGLIPEDHKH
FIGTFWGAVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVQPDRVVIGN
GPTFGCVLMKDFLSALAKRLKRNNTAYENYFRIFVPEGLPVKSEPREPLRVNVLFQHIQN
MLSSETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIA
CIGDGSFQVTAQDVSTMLRCGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAI
HNGQGHCWTTKVFCEEELVEAIETATGPMKNCLCFIEVIVHKDDTSKELLEWGSRVSSAN
SRPPNPQ
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaacctaggatccctcgaagcatgcaaatcaccatgcaacgacataataaca
acaccttcatcaaacggcactgtttccacaatccaaaaatccccctcaacccaatcccta
gcttcatctgaatcaaccctaggcagccacttagctcggcgactagtggaagtcggtatc
accgacatcttcaccgtccctggtgacttcaacctgacgttgctcgaccacttgatcgct
gaaccgaagctgaaaaacatcggttgctgtaacgaacttaatgctggatatgctgctgat
ggatatgcaaggtctagaggtgtgggagcttgtgttgttacatttactgttggtgggtta
agtgtgattaatgcaattgctggtgcttatagtgagaatttgccagtgatttgtattgtt
ggtggaccaaattctaatgattttgggactaatagaattcttcatcatactattggtttg
cctgattttagccaggaacttaggtgtttccagactgttacttgctaccaggctgtggtc
aacaacttggaagatgcacatgaaatgattgacactgcaatctcaacagcactgaaagaa
agcaagcctgtttatataagcataagctgtaacttagcttccattcctcaccctactttc
agccatgaacctgttccattttccttgtctccaaaattgagtaatccaatgggattagag
gcagcagtggaagcagctgcagagtttctcaacaaagcagtgaaaccggtactagtagcc
ggtccaaaactaagagtagcgaaagcatgtgaagcttttattgagctagctgataaaagt
gcttatccatattcagtcatgccatctgccaaaggactaattcctgaggatcacaaacat
ttcattggaacattttggggtgcagtgagcactgcattttgtgccgagattgtggaatcg
gctgatgcatacctatttgctggacctattttcaatgattacagttctgttggatactca
cttcttttgaagaaagaaaaagctattattgttcagcctgatagggttgtgattggaaat
ggtcctacatttgggtgtgtcttgatgaaggattttcttagcgcgctcgcgaagcgtctt
aagaggaacaatactgcttatgagaattatttcaggatttttgttcctgaaggtttgccg
gtgaaatctgaacctagagagcctttgagggttaatgttctttttcaacatattcagaat
atgttgtcgagtgaaactgctgttattgccgagacaggggactcatggtttaactgccaa
aagctgaaattgccaaaaggatgcggttatgagttccaaatgcaatatggttcaattgga
tggtctgttggtgcaactcttggttatgctcaagctgttccggagaagcgagtgattgct
tgcattggtgatggaagtttccaggtgacagcacaggatgtttccacaatgctgagatgt
ggtcagaagaccataatcttcttgattaacaatggtggatacactattgaagttgaaatc
catgatggaccatacaatgtgatcaagaactggaattacactggcttagttgatgctatc
cacaatggtcaaggacattgctggaccaccaaggtcttttgtgaagaggagcttgttgaa
gcaattgagacagcaacaggaccaatgaagaattgcttatgctttattgaggtgattgtt
cacaaggatgacactagcaaagagttgcttgagtggggatcaagggtttcttctgcaaac
agtcgtcctcctaatcctcagtga

DBGET integrated database retrieval system