KEGG   Medicago truncatula (barrel medic): MTR_5g082620Help
Entry
MTR_5g082620      CDS       T01716                                 

Definition
(RefSeq) phosphatidylinositol-specific phospholipase C
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00562  Inositol phosphate metabolism
mtr01100  Metabolic pathways
mtr04070  Phosphatidylinositol signaling system
mtr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MTR_5g082620
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MTR_5g082620
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MTR_5g082620
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MTR_5g082620
Membrane trafficking [BR:mtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    MTR_5g082620
 Endocytosis
  Macropinocytosis
   Phospholipase C
    MTR_5g082620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like DUF1319 DUF4252 DUF2264
Motif
Other DBs
NCBI-GeneID: 11423057
NCBI-ProteinID: XP_003616636
UniProt: G7KH12
Position
5
AA seq 589 aa AA seqDB search
MSKQTYSVCLCWRRRFKLALSEAPQEIKTLFEQYSENDLMTPSNLKRFLIEIQKQEQATE
EEAQAIIDSFKHFHRRGAGLNLETFFKFLFSDSNLALLPSIGVHHDMTLPLSHYFIYTGH
NSYLTGNQLSSDCSDIPIVKALQRGVRVIELDLWPNASKDNVDVLHGRTLTTPVELIRCL
RSIKEHAFVASEFPVVITLEDHLTPDLQAKVAEMVTSTFGDILFVPGSESLKEFPSPESL
KKRIIISTKPPKEYLETKEVKEKEDDSLHGKASGDDEAWGTEIPSFKLGLLSDYKGNSLD
KEYFHDEEELSESDKSHHNVAPEYKGLIAIHAGKSKGGIDAWLKIDPEKARRISLSEQQL
EKAAITHGKEVVRFTQKNILRVFPKGTRIDSSNYNPLIGWIHGAQMVAFNMQGYGRSLWL
MHGMFRANGGCGYVKKPDFLLTTGPDNEVFDPKAKLPVKTTLKVTVYMGEGWYYDFKHTH
FDQYSPPDFYARVGIAGVPSDSIMKKTRAIEDNWLPTWNEVFEFPLTVPELALLRIEVHE
YDMSEKDDFGGQTCLPVSELRSGVRAVSLHSQKGDKYNSVKLLMRFEFH
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaacatacagtgtttgtttatgctggcgtagaagattcaagctagcttta
tcagaagcaccacaagagatcaagaccctctttgaacaatactcagaaaatgatctcatg
acaccttcaaacctcaaaagattcttaattgaaatacaaaaacaagaacaagctactgaa
gaagaagcacaagctatcattgatagtttcaagcattttcatagaaggggtgctggactt
aatcttgaaacttttttcaagtttctctttagtgatagtaaccttgctcttttaccttca
attggggtgcaccatgatatgacattgcccttgtctcattatttcatatatactggtcac
aattcctatctaaccgggaatcagctgagcagcgactgcagcgacattccaatcgtgaaa
gcgttgcagagaggtgtaagggtaattgagttggacttatggcctaatgcatccaaggat
aatgttgatgttcttcatggaaggacattgactactcccgtggagctcattagatgcttg
aggtctattaaggaacatgccttcgtcgcatcagaatttccggttgtaataaccctagaa
gaccatcttactccagatcttcaagccaaagtggccgagatggttacttcaacatttgga
gacatactatttgtacctggctcagaaagcttgaaggaatttccttctcctgaatcactt
aaaaagaggattattatatcaaccaaaccacctaaggagtaccttgagacaaaagaagta
aaggaaaaagaggatgattcactgcacggaaaggcttcgggcgacgatgaagcgtggggg
acggagatcccgagcttcaagttaggtttgttatccgattacaagggaaacagtttggat
aaagaatattttcatgacgaggaagagctttccgaatcagacaagtcacatcacaacgta
gctccagaatataaaggtttaattgccattcatgctgggaagtcgaaaggaggaatagac
gcatggctcaaaatagatccggagaaagcgaggcgtataagtttaagtgagcaacagctt
gaaaaggctgctataactcatggaaaagaagttgtcaggtttactcagaagaatattctg
agggtgtttccaaaaggtactcgcattgactcgtcaaattataatccattaattgggtgg
attcatggagctcaaatggttgcattcaacatgcagggatatgggagatcactttggttg
atgcatggaatgtttagagccaatggagggtgtggttatgttaaaaaaccagattttctc
ttaacaactggtccggataacgaggtctttgatcctaaagctaagttacctgtgaagact
actttgaaggtgactgtatatatgggagaaggatggtattatgatttcaaacatacacac
tttgatcaatattcacctccagatttctatgcaagagttgggattgctggagtccctagt
gatagtataatgaaaaaaacaagggcaatagaggataattggctgcctacatggaacgag
gtatttgagttcccgcttactgttccggaactagcccttcttcgtatagaagttcacgag
tatgacatgtccgagaaagatgattttggtggccaaacatgcctacctgtttcggagcta
aggagcggcgttcgagcagtttccctgcatagccagaagggagataaatacaattctgta
aagcttcttatgcgctttgaatttcattga

DBGET integrated database retrieval system