KEGG   Medicago truncatula (barrel medic): MTR_6g015320
Entry
MTR_6g015320      CDS       T01716                                 

Definition
(GenBank) malonyl-CoA:isoflavone 7-O-glucoside malonyltransferase
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00943  Isoflavonoid biosynthesis
mtr00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    MTR_6g015320
   00943 Isoflavonoid biosynthesis
    MTR_6g015320
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     MTR_6g015320
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-ProteinID: KEH25061
UniProt: A0A072U6Q7
Position
6
AA seq 457 aa
MESSTSPIKVHQVLSIAPQNETFPTTFPLTFFDTLWVRLPPVERLFFYELPNVSTTSFFD
SILPNLKHSLELTLQHFLLLVGNIIWPQDSSHPIINYVPSDSIPLIVAESNENFNILCSN
LCEVEKRKNLIPSLEISHEKASIISLQVTFFPNHGFCIGITTHHAAVDGKSSTLFMKAWS
YFCSNLEKNTPSLFLPQNLTPFFDRSIIKDPLGINEIHSKKWMNFGGETNNRSLKVWQTI
SATKGEAIKGLFELSLLDIQKLKKYAQSKVENKKVSTFAVTCAYLLSLGVKVDQQKPNKA
FLVFAVDCRSRLDPPINENYFGNCIVSRLVVHETEALLEDGGFISALKGIIDVLNDLENG
VLNGLENWMSMMQSKTSRTDETYKIFSITGSPRFEVYSFDFGWGKPKKVDVTSVDRPGAF
YLSGNRNNDGGIEIGLTLNKQQMEDFARLFVQGLESL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggaatcatcaacatctccaatcaaagttcatcaagttctttcaatagcaccacaaaat
gaaacctttccaaccacttttcccttaactttctttgacacactatgggtaagactccca
ccagttgaacgtctcttcttctatgaactcccaaatgtatcaaccacttctttctttgat
tcaattcttccaaatctcaaacactctcttgaactcacactccaacacttcctccttctt
gttggtaacatcatatggccacaagattcatcacatcccatcatcaactatgtccctagt
gattccattcccttaattgtagctgagtcaaatgaaaatttcaatattttatgttccaat
ctttgtgaagttgaaaaaagaaaaaacttaatcccaagtttggaaatttcacatgaaaaa
gcatcaattatttcactacaagtcactttttttcctaaccatggattttgtattggtata
accacacaccatgcagctgttgatggaaaatcttcaaccttgtttatgaaagcttggtct
tatttttgttccaaccttgaaaaaaacacaccctctttgtttttacctcaaaatctaaca
cctttttttgataggtccattataaaagaccctttaggaataaatgaaattcattcaaaa
aaatggatgaattttggtggagaaacaaataatcgtagcttaaaggtttggcaaacaata
agtgcaacaaaaggtgaagcaatcaaaggtttgtttgaattatcacttttggatattcaa
aagcttaagaaatatgcacaatctaaggttgaaaataaaaaggtttcaacttttgcggtt
acatgtgcttatttgttgtcattaggggttaaagttgaccaacaaaaacccaataaggca
tttttggtttttgctgttgattgtaggtcacgcttggatccaccaattaatgaaaattat
tttgggaattgtattgtgtcaagattagttgtgcatgaaactgaggcattgttggaagat
ggtgggtttattagtgctcttaaagggataattgatgtgttgaatgatttggaaaatggt
gtgttaaatggtttggaaaattggatgtcaatgatgcaatctaaaacatctagaacggat
gagacttataagattttttctattaccgggtcacctaggtttgaggtgtatagttttgat
tttgggtggggtaagcctaagaaagttgatgttacttcggttgatagaccaggagctttt
tatctttcgggaaataggaataatgatggtggaattgagattggtttgactttgaacaag
caacaaatggaagattttgctcgactttttgttcaaggacttgaatccttgtaa

DBGET integrated database retrieval system