KEGG   Medicago truncatula (barrel medic): MTR_6g035305Help
Entry
MTR_6g035305      CDS       T01716                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic-like protein
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00030  Pentose phosphate pathway
mtr00051  Fructose and mannose metabolism
mtr00710  Carbon fixation in photosynthetic organisms
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01200  Carbon metabolism
Module
mtr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
mtr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mtr_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
mtr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_6g035305
   00030 Pentose phosphate pathway
    MTR_6g035305
   00051 Fructose and mannose metabolism
    MTR_6g035305
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_6g035305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtr04147]
    MTR_6g035305
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MTR_6g035305
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTR_6g035305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase zf_CCCH_4 zf-CCCH
Motif
Other DBs
NCBI-GeneID: 25496103
NCBI-ProteinID: XP_013451828
UniProt: G8A0S6
Position
6
AA seq 339 aa AA seqDB search
MDHSADAHRTDLMTITRFVLNEQSKHPESRGDFTILLNNIVLGCKFVCSAVNKAGLAKLI
GLAGETNVQGEEQKKLDVLSNEVFCKALISSGRTCILVSEEDEDAIFVEPKQRGKYCVVF
DPLDGSSNIDCGVSIGTIFGIYMMKDNHEPVIEDALQPGKNMLAAGYCMYGSSCTFVITT
GSGVNGFTLDPSLGEFILTHPDIKIPKKGKIYSVNEGNAKNWDGPTAAYVEKCKFPTDGS
PAKSLRYIGSMVADVHRTLLYGGTFLYPADKKSPNGKLRVLYEVFPMSFLMEQAGGQAFT
GKERALDLIPTKLHERSPIFLGSYDDIEEIKALYAAEAK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaccacagcgcagatgcacatcgtacagacttgatgaccataacacgttttgtgttg
aatgaacagtctaagcatcctgaatcacgtggagatttcaccatcttgcttaataacatt
gttcttggttgcaaatttgtttgttctgctgttaacaaggctggtcttgctaagctcatt
ggacttgcaggagagaccaatgttcagggtgaagaacagaagaagctggatgttctttcc
aatgaggtgttctgcaaggctttgataagcagtggtagaacatgcatcttggtttctgaa
gaagatgaggatgcaatattcgtggagcctaagcagcgtggaaagtactgtgttgttttt
gatccattagatggctcctccaacattgattgtggtgtttccattggaactatttttggg
atttatatgatgaaagataaccatgaaccagtcatagaagatgctctgcaaccagggaag
aacatgttagcagctggttattgcatgtacggaagctcttgcacgtttgtgataaccact
ggaagtggtgttaatggtttcacccttgacccttctcttggcgagtttatcctaactcac
cctgacattaagatcccaaagaaaggcaagatttattcggtgaatgaagggaacgccaag
aactgggatggtcctaccgctgcttatgtggagaaatgcaagtttccaacagatggttca
ccagcaaagtctctaagatatattggaagcatggtagctgatgttcatcgtacattgcta
tatggaggtacctttttgtaccctgctgacaaaaagagtccaaatggaaaacttcgtgta
ttgtatgaagtcttcccaatgtccttcttgatggaacaggcaggaggtcaggctttcact
ggcaaggaaagggcacttgatttaattccaacaaaattgcatgaaagatctccaatattt
cttggtagctatgatgatatcgaggaaatcaaagctctttatgctgcagaggctaaataa

DBGET integrated database retrieval system