KEGG   Medicago truncatula (barrel medic): MTR_6g068930Help
Entry
MTR_6g068930      CDS       T01716                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00350  Tyrosine metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_6g068930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MTR_6g068930
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MTR_6g068930
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MTR_6g068930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N AlaDh_PNT_C Sacchrp_dh_NADP Phage_holin_5_2
Motif
Other DBs
NCBI-ProteinID: AES76000
UniProt: G7KPC5
Position
6
AA seq 377 aa AA seqDB search
MASSSTPQVITCKAAVAWGAGEALVMEEVEVSPPQPLEIRIKVVSTSLCRSDLSAWETHA
IFPRIFGHEASGIVESVGLGVTEFKEGDQVLTVFIGECMSCKLCKSGKTNICQVLGLERK
GLMHSDQKTRFTVKGKPVYHYCGVSSFSEYTVVHSGCAVKVSPHVPLEKICILSCGVSAG
LGAAWNVADVSKGSTVVIFGLGTVGLSVAQGAKLRGASRIIGVDNNPQKCENAKSFGITE
VVDPSLYKEPIAQVIKRITDGGADFCFECAGDTDMITTALQSCCDGWGLTVTLGVPKVKP
EMSAHYGLFLTGRTLKGSLFGGWKPKTDLPSLVEKYVNKEIQIDDYITHNLSFDEINKAF
NLMKEGKCLRCVIHMSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcatcaacccctcaagtcataacctgcaaagctgcagtagcatggggagct
ggagaggcattggtgatggaggaagtggaagtcagtcctcctcaaccattggagattagg
attaaggttgtttccacctctctctgtcgtagtgatctttctgcttgggaaactcatgcc
atatttcctcgcatatttggccatgaagcatctgggattgttgagagtgtagggctagga
gtgactgaattcaaagaaggcgaccaagtgttaacagttttcattggagaatgcatgtca
tgcaagctgtgcaaatcaggaaaaactaatatttgtcaagttttgggattggaaagaaag
ggtttaatgcatagtgatcaaaagacaagatttacagtaaaagggaagcctgtttatcat
tattgcggtgtttcaagttttagtgaatacacagttgtccattctggatgtgcagtgaaa
gtcagtcctcatgtacctcttgagaaaatatgcattcttagctgtggggtttctgcaggt
ctaggtgcagcatggaatgttgccgatgtgtcaaaaggatcaacagtggttatatttggt
cttggaactgttggcctttctgttgcacaaggggcaaaactaaggggtgcatctagaata
attggtgttgacaacaatccacagaagtgtgaaaatgctaaatcttttgggattacagaa
gttgttgatccgagtttgtacaaagaacctatcgcgcaggttattaagcgcattactgac
ggcggagcagatttctgttttgaatgtgctggtgacactgatatgataaccactgccttg
caatcatgctgtgatggatggggcttgactgtaacactaggtgtgccaaaggtgaagcct
gagatgtcagctcattatggactattcctgacaggaagaactttaaaaggatctttattt
ggaggatggaaacctaaaactgatcttccttcattagtagagaagtatgtgaacaaggaa
atccagattgatgactacataacacacaatttgtcatttgatgaaattaacaaagctttc
aatctcatgaaagaaggaaagtgtcttcgttgtgttatccacatgtcaagataa

DBGET integrated database retrieval system