KEGG   Medicago truncatula (barrel medic): MTR_7g011590Help
Entry
MTR_7g011590      CDS       T01716                                 

Definition
(GenBank) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03040  Spliceosome
mtr04141  Protein processing in endoplasmic reticulum
mtr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MTR_7g011590
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MTR_7g011590
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MTR_7g011590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mtr01009]
    MTR_7g011590
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mtr03041]
    MTR_7g011590
   03009 Ribosome biogenesis [BR:mtr03009]
    MTR_7g011590
   03110 Chaperones and folding catalysts [BR:mtr03110]
    MTR_7g011590
   04131 Membrane trafficking [BR:mtr04131]
    MTR_7g011590
   03051 Proteasome [BR:mtr03051]
    MTR_7g011590
   03029 Mitochondrial biogenesis [BR:mtr03029]
    MTR_7g011590
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtr04147]
    MTR_7g011590
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MTR_7g011590
Spliceosome [BR:mtr03041]
 Complex B
  Other components
   Prp19 complex
    MTR_7g011590
 Complex C
   Prp19-CDC5 complex
    MTR_7g011590
Ribosome biogenesis [BR:mtr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    MTR_7g011590
Chaperones and folding catalysts [BR:mtr03110]
 Heat shock proteins
  HSP70 / DNAK
   MTR_7g011590
Membrane trafficking [BR:mtr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    MTR_7g011590
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    MTR_7g011590
Proteasome [BR:mtr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    MTR_7g011590
Mitochondrial biogenesis [BR:mtr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    MTR_7g011590
Exosome [BR:mtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MTR_7g011590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR DUF357 DUF4843 Stathmin
Motif
Other DBs
NCBI-ProteinID: AES77518
UniProt: G7L328
Position
7
AA seq 604 aa AA seqDB search
MAKKYEGCAVGIDLGTTYSCVAVWLDEHNRVEIIHNDQGNKTTPSFVAFTDDQRLVGDAA
KNQAPTNPENTVFDAKRLIGRKFGDSVVQNDMMLWPFKVICGVNDKPMISVKCKGQEKHL
CAEEISSMVLTKMRKTAEEFLELPVKNAVVTVPAYFNDAQRKATIDAGVIAGLNIMRIIN
EPTAAAIERNIFIFDLGGGTFDVSLLTIKDKVFQVKAIAGNTHLGGEDFDNRMVNYFARE
FKKKNKVDISENSRALRRLKTACERAKRILSFAVITTIEIDSLFQGFDLFSSITRAKFEE
INMDLFTECLETVKSCFADVEMDKSAIHDVVLVGGSSRIPKVQQLLQEFFAGKHLCNSIN
PDEAVAYGAAVQAALLSEDFKNVPNLVVQDVAPLSLGIEVIGDIMGVVIARNTSIPIKKT
KGYSTASDNLTSVLIKVYEGERARASDNNLLGSFCLSVPSAPRGHPFEVCFTINENGILI
VSANEKSTGSTNEITVTNDKERLSSQEIIKMIKEAENYRVEDEKFLRKANVMNALDYCVY
KMKNALKKKDVNINLSSQENDKINSAITKATSLLDSTQQSEIDVLENHLKELESLLKLII
GKSV
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagtacgaaggatgtgcagtgggaatcgaccttggaacaacgtattcgtgc
gttgctgtttggctcgatgagcacaacagagttgagattattcacaatgaccaaggcaac
aaaaccacaccttcttttgttgctttcactgatgatcaaaggttggttggtgatgctgct
aagaatcaagctcccacaaaccctgaaaacactgtttttgatgcaaagaggttaattggt
aggaagtttggtgattctgttgttcaaaatgatatgatgttgtggccattcaaggtcatt
tgcggagtgaatgacaaacccatgatttcggttaagtgcaagggacaggagaagcaccta
tgtgctgaagaaatctcatctatggttctaacaaagatgcgcaagactgcagaggagttt
ttagaattgcctgtcaagaatgcagttgttaccgtacctgcttatttcaatgatgctcag
cggaaagcgacaatagatgctggtgttattgctggccttaatattatgcggataatcaat
gaacctactgctgcagctattgagcgtaatatttttatctttgacttgggtggtgggact
tttgatgtgtctcttcttacaattaaggataaggtctttcaagttaaggccatcgcagga
aacacccaccttgggggagaggactttgataataggatggtgaactactttgcacgggag
tttaagaagaagaacaaggtagacattagtgagaactcaagagccttaaggaggttgaaa
acggcgtgtgaaagagcaaaacgaatactatcttttgctgtcatcaccaccattgagata
gattctttatttcagggatttgacttattttcatcaatcactcgtgccaagtttgaggaa
atcaatatggatcttttcactgagtgtttggaaactgttaagagttgtttcgctgatgtc
gaaatggacaaaagtgctatacatgatgtcgtccttgtcggtggctcgtctagaattcca
aaagtgcaacaactattgcaggaattttttgcagggaagcatctgtgtaacagcatcaac
cctgatgaggccgttgcttatggtgcagctgtgcaagctgctttgttgagtgaagacttt
aaaaatgttccaaacttggtggtgcaagatgttgctcctttgtctcttggtatcgaagtt
ataggtgatatcatgggtgtcgtaattgctagaaacactagcattcctatcaagaaaaca
aaaggttattcaacggctagtgataacctaacttcagtcctcatcaaagtttatgagggt
gagagagcaagagctagtgacaacaatctgcttggttctttttgtctttctgtcccaagt
gctcctcgcggtcacccttttgaggtatgctttactatcaatgaaaatggcatcttaatt
gtttctgctaatgaaaaatccactggtagtacgaatgagattacagtaactaatgacaaa
gaaagattgtcatcccaagaaattataaaaatgatcaaagaagctgaaaattaccgtgtt
gaggatgaaaaatttctaaggaaggccaatgtaatgaatgcattagattattgtgtttac
aagatgaaaaatgctttaaagaagaaggatgtgaatataaatctctcctctcaagaaaat
gacaagatcaattctgcaatcacaaaggccacaagtttacttgatagtacccagcagagt
gaaatagatgttcttgaaaatcacctgaaggagcttgagagtctgctcaaactcattata
ggcaaatctgtctag

DBGET integrated database retrieval system