KEGG   Medicago truncatula (barrel medic): MTR_7g021770Help
Entry
MTR_7g021770      CDS       T01716                                 

Definition
(GenBank) ribulose bisphosphate carboxylase large chain domain protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00630  Glyoxylate and dicarboxylate metabolism
mtr00710  Carbon fixation in photosynthetic organisms
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01200  Carbon metabolism
Module
mtr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mtr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mtr_M00532  Photorespiration
mtr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MTR_7g021770
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_7g021770
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MTR_7g021770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AES77912
UniProt: A2Q5A2
Position
7
AA seq 475 aa AA seqDB search
MSPQTETKATVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVSPQPGVPAEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAA
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREATKWSPELAAACEVWKEIKFELPAMDTI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaacggttgggttcaaagctggtgttaaagattat
cgattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattc
cgagtaagtcctcaacctggagttccggctgaagaagcaggtgcagcggtagctgccgaa
tcttccactgggacatggacaaccgtgtggaccgatggacttaccagtcttgatcgttat
aaaggacgctgctaccacatcgaacctgttgctggagaagagagtcaatttattgcttat
gtagcttatcccttagacctttttgaagaaggttctgttactaacatgtttacctccatt
gtaggtaatgtatttgggttcaaggccttgcgtgctctacgtctggaagatttgcgaatc
cccgttgcttatgttaaaactttccaaggtcctcctcacggaatccaagttgagagagat
aaattgaacaaatatggacgtcccctattgggatgtactattaaacctaaattgggttta
tccgctaaaaattacggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgaaaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaagcacaggccgaaactggtgaaatcaaaggacattatttg
aatgctactgctggcacctgtgaagacatgatgaaaagagctgtatttgctagagaattg
ggcgtgcctatcgtaatgcatgactacttaaccggtggattcactgcaaatactaccttg
gctcactattgccgcgataatggtctacttcttcatatccaccgtgcaatgcatgcagct
attgatagacagaaaaatcatggtatgcactttcgtgtattagctaaagcgttacgtatg
tcaggtggagatcatattcacgctggtactgtagtaggtaaactggaaggagaaagggat
attactttaggttttgttgatttactacgtgatgattttgttgaaaaagatagaagtcgc
ggtatttttttcactcaggattgggtttctttacctggtgttctgcctgttgcttcaggt
ggtattcatgtttggcatatgcctgctctgaccgagatatttggagatgattctgtactt
caattcggtggaggaactttaggacacccttggggaaatgcacctggtgccgtagcgaat
cgagtagctctggaagcatgtgtacaagctcgtaatgaaggacgtgatcttgctcgtgag
ggtaatgaaattatccgtgaagctaccaaatggagtcctgaattagctgctgcttgtgaa
gtctggaaggagatcaaatttgaactcccagcaatggatactatttaa

DBGET integrated database retrieval system