KEGG   Medicago truncatula (barrel medic): MTR_7g074710Help
Entry
MTR_7g074710      CDS       T01716                                 

Definition
(GenBank) dihydroflavonol 4-reductase-like protein
  KO
K13265  vestitone reductase [EC:1.1.1.348]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00943  Isoflavonoid biosynthesis
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    MTR_7g074710
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.348  (3R)-2'-hydroxyisoflavanone reductase
     MTR_7g074710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 KR NmrA Polysacc_synt_2 adh_short RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AES79922
UniProt: A2Q3W4
Position
7
AA seq 326 aa AA seqDB search
MAEGKGRVCVTGGTGFLGSWIIKSLLENGYSVNTTIRADPERKRDVRFLTNLPGASEKLH
FFNADLSNPDSFAAAIEGCVGIFHTASPIDFAVSEPEEIVTKRTVDGALGILKACVNSKT
VKRFIYTSSGSAVSFNGKDKDVLDESDWSDVDLLRSVKPFGWNYAVSKTLAEKAVLEFGE
QNGIDVVTLILPFIVGRFVCPKLPDSIEKALVLVLGKKEQIGVTRFHMVHVDDVARAHIY
LLENSVPGGRYNCSPFIVPIEEMSQLLSAKYPEYQILTVDELKEIKGARLPDLNTKKLVD
AGFEFKYTIEDMFDDAIQCCKEKGYL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggaaaaggaagagtttgtgtgactggaggtacaggttttcttggttcatgg
attatcaagagtcttcttgaaaatggatactctgtcaataccactattagagctgatcca
gaacgtaagagggatgttagattcctgacaaatctacccggtgcatccgaaaagctacat
ttcttcaacgccgatctaagcaacccagacagtttcgctgcagcaatcgaaggctgtgtc
gggatattccacaccgcttcgccaattgacttcgctgtgagtgaaccagaagaaatagtg
acaaaaagaacagtcgacggcgcattaggcattttaaaagcatgtgtgaattcaaagaca
gtgaagagatttatatacacttcaagtggttctgctgtttcattcaatggaaaagacaaa
gatgtgttggatgagagtgattggagtgatgttgatttgcttagaagtgttaaaccattt
ggttggaattatgctgtttctaagacattggctgagaaagctgttcttgaatttggtgaa
caaaatggaattgatgttgttactttgattcttccttttattgttggtcgttttgtttgc
cctaagcttcctgattctatcgagaaagctcttgttttggtattagggaaaaaagaacaa
attggtgtgacacgtttccacatggtacatgttgatgatgtagctagagcacatatatat
ctacttgagaattctgttccaggaggtagatacaattgctcaccattcattgtacctatt
gaagagatgtctcaacttctttcagccaaatatccagaatatcaaatactaacagtagat
gagttgaaggaaattaaaggtgcaaggttaccagatttaaacacgaagaaactcgtggac
gctggtttcgaatttaagtacactatcgaagatatgttcgacgatgcaattcaatgttgc
aaggagaaaggctatctataa

DBGET integrated database retrieval system