KEGG   Medicago truncatula (barrel medic): MTR_7g094600Help
Entry
MTR_7g094600      CDS       T01716                                 

Definition
(GenBank) phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00480  Glutathione metabolism
mtr00590  Arachidonic acid metabolism
mtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MTR_7g094600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MTR_7g094600
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MTR_7g094600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin YfkB
Motif
Other DBs
NCBI-ProteinID: KEH23732
UniProt: I3SBH6
Position
7
AA seq 170 aa AA seqDB search
MGASHSVSENSIHEFTVKDARGKDVNLSTYKGKVIIVVNVASKCGFTNVNYTQLTELYSR
YRDKGLEILAFPCNQFLNQEPGNSLEAEQFACTRFKAEYPIFGKIRVNGPDTAPLYKFLK
EKKSGFLGSRIKWNFTKFLVDKEGHVLQRYSPTTSPFSIENDIKKALGET
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcttcacattcggtctctgaaaattcaatccatgaattcacagttaaggatgca
aggggaaaagatgtgaacctaagcacttacaaagggaaagtgattattgtagttaacgtt
gcttcgaaatgtggatttacgaatgtcaattatacccagttaactgagctttacagcaga
tacagggataaaggacttgagatattggcttttccatgcaatcagtttttgaatcaagag
ccggggaatagtctggaggcagagcaatttgcctgcacaagattcaaagccgagtatcca
attttcggaaagatacgtgtgaatggacccgacacagcacctctctacaaattccttaaa
gaaaagaaatctggttttctggggtctaggataaagtggaacttcaccaagtttttggtt
gacaaggaagggcatgtgctccagcgttacagtccaaccacctcaccattttccatagaa
aatgacatcaagaaggcattgggagagacttga

DBGET integrated database retrieval system