KEGG   Medicago truncatula (barrel medic): MTR_7g099920Help
Entry
MTR_7g099920      CDS       T01716                                 

Definition
(GenBank) eukaryotic translation initiation factor 3a
  KO
K03254  translation initiation factor 3 subunit A
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    MTR_7g099920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mtr03012]
    MTR_7g099920
Translation factors [BR:mtr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    MTR_7g099920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-ProteinID: AES81724
UniProt: G7L0K9
Position
7
AA seq 959 aa AA seqDB search
MTSFLKPENALKRAEELINVGQKQDALQTLHDLITSKRYRAWQKTLERIMFKYVELCVDM
RKGRFAKDGLIQYRIICQQVNVSSLEEVIKHFMHLSTEKAEQARSQAQALEEALDVDDLE
ADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLEALYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLSAPESLQLYLDTRFEQLKI
ATELELWQEAFRSVEDIHGLMCMVKKTPKPSLMTVYYVKLTEIFWKSSSHLYHAYAWFKL
FLLQKSFNKNLGQKDLQLIASSVVLAALSVPPHDRTHGASHLELEHEKERNLRMANLIGF
NLETKPDSREVLSRSSLLAELASKGVMSCVSQEVKDIYYLLENEFLPSDLALKVLPLLNK
ISKLGGKFTFASSVPEVQFSQYVPALEKLATLRLLQQVSNVYQSMKIENLAGMIPFFDFS
VVEKISVDAVKQKFLSMKVDHMKNVVIFCKTSLEADGLRDHLASFAEQLNKARQMICPPD
RKQSKLGALLPTLSEVVAKEHKRLLARKSIIEKRKEEQERQLLEKEREEESKRLRLLKID
EEAEQRRLATEIEQRKIQRLQREKEERDREEAEALRLEAEKRLKRKGKKPVIEGGQISRE
SLMQLTLVEQVRERQEMEKKLQKLAKTMDHLERAKREEAAPLIDAAYQQRLVEERVLHER
EQQLEVELSRQRHAGDLNEKERLSRMMGNKEIYQERVVSHRQAEFNRLQRDRLDRISKIL
LSRKQEREKMRKLKYYLKVEEEKRQKLREEEEAREREEAERKKKEQAERQAKLDEIAEKQ
KQRLREIEEKAEREKREALLGRPAEPALRPYEPPVRPVDPGTAAPAAAAAAPAPGKYVPK
FRRGGGETAGAPPPEADRWGNSGSRPDGDRWDRNSSSFGSGGGSRSSSTWSSSRMRDRT
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatttttgaagcctgagaatgctctcaaaagggcagaagagttgatcaatgtc
gggcagaagcaggatgctcttcagactctgcacgacctgatcacttcgaaaagatatcgc
gcatggcagaaaacactggagagaattatgtttaagtatgtcgagctttgtgttgacatg
aggaaaggccgatttgctaaggatggcctcattcagtatcgtataatatgtcagcaagtg
aatgttagctcactggaggaggtgatcaagcacttcatgcatctgtcaacagagaaagct
gaacaagcacgtagtcaggctcaggctttggaagaagcccttgatgtggatgacctggag
gctgataaaaggccagaggatttgatgctgagctatgttagtggcgagaaaggaaaggat
agatctgatcgggagcttgttacgccatggtttaaatttctatgggaaacttacaggaca
gtgcttgaaatattgcggaacaactccaaattggaagccttatatgctatgacagcccat
cgagctttccagttttgtaagcagtataagcgaacaacagaatttcgcagactctgtgaa
attatcagaaatcatttggctaatcttaacaaatatcgggaccaacgagaccggcctgac
ctttctgctcctgaaagcttgcaattgtatcttgatacaagatttgagcagctgaaaatt
gccactgaacttgaactctggcaggaagccttcagatctgttgaagatattcatggatta
atgtgcatggtcaagaaaacacctaaaccatccttgatgactgtttactatgtcaagttg
acagaaatattttggaaatcttcaagtcatttatatcatgcttatgcatggtttaagctc
tttttgttacagaaaagcttcaacaaaaatcttggtcaaaaggatttgcaattaatagct
tcatctgttgttctagctgcactctcggtgcctcctcatgatcgcactcatggtgcatct
catttagaactagagcatgaaaaagagcgaaatttgaggatggctaatctcataggcttt
aatcttgaaactaagcctgatagcagagaagtgctctcaaggtcgtcacttcttgctgaa
ctggcttcaaagggtgtaatgtcttgtgtatcacaagaagtgaaagacatttactatctc
ttggaaaatgaatttctaccctcagatcttgcactaaaagtactacccttgctaaataaa
atttcgaaattggggggtaagtttaccttcgcttcatctgttccagaggtgcaattttcg
cagtatgtcccagctcttgaaaagttggctaccttgaggttgctacaacaggtgtctaat
gtttaccaatcaatgaagattgagaacttagctgggatgatccctttctttgatttttcg
gttgtggaaaagatttctgtagacgctgttaagcagaaatttctatcaatgaaagtggac
cacatgaaaaatgttgtaattttctgtaagacgagtcttgaagctgatggcttgagggat
cacttggctagttttgctgaacaattgaataaggcaaggcaaatgatttgtcctcctgat
aggaaacaatcaaaacttggagcattgctcccaactttgtcagaggttgtggccaaagaa
cacaagaggctccttgctcgaaaatccattattgagaaaaggaaagaggaacaagaacgg
cagcttcttgaaaaggaacgcgaggaggagtcaaagaggttgagactgctgaaaattgat
gaagaagcagagcaaaggcggcttgcaactgagattgagcagaggaaaattcaaagactc
caaagggaaaaggaggaaagagacagagaagaagccgaggctttacgtctggaagctgaa
aagcgtttgaagagaaagggcaaaaagcctgtgatagaagggggccaaatttctagggaa
tccttgatgcagttgacgttggtcgaacaagtccgggagagacaggaaatggagaagaag
cttcagaaattggccaaaaccatggatcatttggaaagagcaaagagagaagaggctgct
ccgctaattgatgctgcatatcaacagcgattagtggaagagagggttcttcatgagcgt
gagcaacaactagaagttgaactaagcagacagcgccatgctggagatctcaatgagaag
gagaggcttagtcgaatgatgggcaataaagagatatatcaagagagagttgtgagtcac
cgccaagcggaattcaataggttgcagagagacaggctggacaggatctctaagatttta
ctctccaggaaacaggagagggaaaaaatgagaaaattgaagtattatcttaaggtggaa
gaagagaaaagacagaaattgcgtgaggaggaagaagctcgggagcgtgaagaggctgag
agaaaaaagaaggaacaggctgaacgccaagctaaattggatgagatagctgaaaagcaa
aaacaaagacttagagaaattgaagaaaaggctgagagggagaagagggaagcattgttg
ggcagacctgctgaaccagctctgaggccttatgagcctcctgtccgtccagttgatcct
ggtactgctgctccagctgcagctgcagcagccccagctccagggaagtatgttcccaag
ttccggcgaggaggaggtgaaacagcaggagctcctcctccagaagcagatcgttggggt
aacagtggcagccggccggatggtgacaggtgggatcgtaattcttcctcatttggttct
ggtgggggttcaaggtcatcttcaacttggtcatcttccaggatgcgtgatcgtacttga

DBGET integrated database retrieval system