KEGG   Medicago truncatula (barrel medic): MTR_7g115690Help
Entry
MTR_7g115690      CDS       T01716                                 

Definition
(GenBank) L-allo-threonine aldolase-like protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00260  Glycine, serine and threonine metabolism
mtr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTR_7g115690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Aminotran_5 Pyridoxal_deC Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: KEH24599
UniProt: A0A072U4C8
Position
7
AA seq 358 aa AA seqDB search
MVTRTVDLRSDTVTKPTETMRVAMANAEVDDDVLGRDPSCFRLEEEMAKITGKEAALFVP
SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPRTVRNNEDGTMDIDL
IEAAIRDPKGELVYPTTRLICLENSHGNTGGRCLSVEYTERVGEVAKQHGLKLHIDGARI
FNASVALGVPVDRLVRAADSVSVCLSKGIGAPVGSVIVGSNSFITKARRLRKTLGGGMRQ
VGILCAAALVALHENVEKLESDHKNARFLADGLNEIKGLRVDTSSVETNIIYIEIEENSG
TTAAKLSKDLEEYGILIMPMGTSRLRVVFHHQISDSDVRYTLSCFERAVAGEPNENGN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaggacagtggatcttcggtcagatacagtcacaaaaccgactgaaacaatg
cgagttgctatggcaaacgctgaggtcgatgatgatgttcttggccgcgacccttcttgt
tttcgcttagaagaagagatggcaaagataacgggaaaagaagctgctctttttgtccca
tcaggcactatggggaacctcatatctgtgcttgttcattgtgacataagagggagtgaa
gttattcttggagacaattcacatattcatatttatgagaatggaggcattgcaaccctt
ggaggtgtacatccaagaacagttagaaataatgaagatggaaccatggatattgatttg
attgaggcggcaattagagatccaaaaggggagcttgtttatccaaccacaaggctcatt
tgtttggaaaattctcatggaaacactggtggtagatgcctttcggttgaatatacagag
agagttggagaagttgctaagcagcatggactgaagcttcacatcgatggagcccgtata
tttaatgcatcagttgcacttggtgttcctgtggataggcttgttcgagcggctgattca
gtgtcagtttgcttatctaaaggtattggtgctccagtgggatctgtaattgttggttcc
aacagctttataaccaaggctagaaggcttagaaagaccttaggtggtggaatgagacag
gttggcatcctttgtgcagctgcacttgttgcattacatgaaaatgttgaaaagctagaa
agtgatcacaagaatgctagatttttggctgatggattgaatgaaatcaaaggactgagg
gtggatacatcttctgtggaaaccaatattatatatattgaaattgaagagaattcagga
accacagcagcaaagctatccaaggacttagaagaatatggcatacttatcatgccaatg
ggaacatcaagattgagagttgtattccaccaccaaatatcagatagcgatgtgcgatac
actttgtcgtgttttgagcgtgctgttgctggagaaccaaatgaaaatggaaactag

DBGET integrated database retrieval system