KEGG   Medicago truncatula (barrel medic): MTR_8g028060Help
Entry
MTR_8g028060      CDS       T01716                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00350  Tyrosine metabolism
mtr00360  Phenylalanine metabolism
mtr00380  Tryptophan metabolism
mtr00950  Isoquinoline alkaloid biosynthesis
mtr00965  Betalain biosynthesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MTR_8g028060
   00360 Phenylalanine metabolism
    MTR_8g028060
   00380 Tryptophan metabolism
    MTR_8g028060
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    MTR_8g028060
   00950 Isoquinoline alkaloid biosynthesis
    MTR_8g028060
   00965 Betalain biosynthesis
    MTR_8g028060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtr04147]
    MTR_8g028060
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     MTR_8g028060
    4.1.1.105  L-tryptophan decarboxylase
     MTR_8g028060
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTR_8g028060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Replicase
Motif
Other DBs
NCBI-GeneID: 25500754
NCBI-ProteinID: XP_013444693
UniProt: A0A072TPD4
Position
8
AA seq 502 aa AA seqDB search
MNTSSSNPPQSDPQKTMNPLDLEEFKRQGYMMIDFLTDYYKNIENYPVLSKVEPGYLAKI
LPSSAPFQPESIESILEDVQQHIIPGITHWMSPNYYAYFPSSGSIAGFIGEMLSTGFNVV
GFNWLSSPAATELETIVMNWLGKLLNLPKSFIFSSNIKGGGEIKKLSQIGKDNIGKLVVY
CSDQTHSALQKATQIVGIHSENFRVIKTKGSNLFALSPDSLLSTILLDVDNGLIPYFLCA
TIGTTSTNAVDPIKLLCNVTKEYDIWVHVDAAYAGSVCICPEFRHCIDGIEELNSFSFNA
HKWFLTNLACCCLWVKDHNALTTSLSTNPEFLRNKKSDSKEVIDYKDWQIPLSRKFNALK
LWIVLRSYGVENLKNFLRNHVEMAKIFEGLVRKDERFEIVVPSKFSLVCFRISPFAISIA
NDSEGYYVGKMMNDAYLVNEMNHKLLDLINSSGKAYMSHGEVEGSFVIRCAIGATLTEEH
HVTMTWKLVQQIASFLLGTPLN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatcaagttccaaccctcctcaaagtgatccacaaaaaaccatgaatcctctt
gaccttgaagaattcaaaagacaaggatacatgatgattgatttccttacagattattac
aaaaacattgaaaactatcctgttttaagtaaagtagaacctggttatcttgcaaaaata
ttaccatcttcagctccatttcaaccagaatcaattgaatcaatacttgaagatgttcaa
caacatataatccctggtatcacacattggatgagtccaaattattatgcttacttccct
agtagtggtagcatagcagggtttataggtgaaatgttaagcactggattcaatgttgtt
ggattcaattggttatcatcaccagctgcaactgagcttgaaactattgttatgaattgg
cttggaaaattgctaaatttacccaaaagtttcattttttcatcaaatattaagggtggt
ggtgagataaaaaaactttctcaaattggaaaggacaatattggaaaacttgttgtgtat
tgttctgatcaaacacatagtgcacttcaaaaagcaactcaaattgttggaattcattca
gaaaattttagagtcataaaaacaaaaggatcaaatttatttgctttgtcccccgactct
ttgctttcgacaattcttttagacgttgacaatggtttgattccttattttttatgcgct
actattggaacaacttcaacaaatgccgttgatcctataaagttgttgtgtaatgtgaca
aaagaatacgatatttgggttcatgtcgacgctgcttatgccggttcagtttgtatttgt
cctgaatttagacattgcattgatggaattgaagagttaaattcttttagctttaatgca
cataaatggtttttgactaatttagcatgttgttgtctttgggtgaaagatcacaatgct
ttaacaacatcattgtcaacaaatcctgaattcttgaggaacaagaaatctgattcaaag
gaagttattgattacaaagattggcaaatacctttaagtaggaaattcaatgcactcaaa
ctatggattgttcttcgaagctacggtgtcgaaaatctcaagaattttttgagaaatcat
gtggaaatggcaaaaatatttgaaggactagtgaggaaagatgagaggtttgaaattgtt
gtgccaagtaaattctctttggtttgttttaggatttctccatttgcaattagtattgct
aatgacagtgaaggttactatgttggaaaaatgatgaatgatgcatatttagtgaatgaa
atgaatcataaattgctagatttaattaatagttctggcaaagcatacatgagtcatggt
gaggttgaaggatcttttgtgattagatgtgctattggtgctaccttaacagaagaacat
catgtgactatgacatggaaattggtgcaacaaattgcaagttttctattaggtactcct
ctcaactaa

DBGET integrated database retrieval system