KEGG   Medicago truncatula (barrel medic): MTR_8g069840Help
Entry
MTR_8g069840      CDS       T01716                                 

Definition
(RefSeq) phylloquinone biosynthesis protein
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00130  Ubiquinone and other terpenoid-quinone biosynthesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MTR_8g069840
Enzymes [BR:mtr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     MTR_8g069840
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     MTR_8g069840
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     MTR_8g069840
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     MTR_8g069840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C Abhydrolase_1 TPP_enzyme_M_2 Abhydrolase_6 Hydrolase_4 TPP_enzyme_C Ndr Abhydrolase_3 Abhydrolase_2 BAAT_C DUF676 Lipase DLH Thioesterase DUF900 DUF2974 DUF726 Esterase
Motif
Other DBs
NCBI-GeneID: 25501491
NCBI-ProteinID: XP_013446183
UniProt: A0A072U318
Position
8
AA seq 1700 aa AA seqDB search
MNLPVPALRSSPFYNASLFLIFPHSHSHSHSSTSSSSPFAIGVTRTVLPKLHVVSGGVRF
DGSLPLNDDDEVVFEHCVTRTLPPALTLEDGLHKLKDALEILKLAPPSCETGFLRFQVLV
PPSSKALSWFCCQPESSGVFPLIFVSKNMDDPTCKSLYVNGSRGVFGIGTAVSFVHSSPG
NKSLIKRYISTDSTDIVAYGFMDINLDNDSVSINHEDGSFSFFIPQIELDEMESVSILTM
TLAWDNFSLSNFGKALHLLEVSLNQVIYHVWSTSSAEKSKCVRAALRKLNLVEDRSIPRV
YINTVARGGTESVGDIMELKESPSSSQFCARLSATLTVSNNMLDHSIEFSHSLNESANIN
AVWASLLVEECTRLGLTYFCVAPGSRSSPLAVAAASHQLITCISCFDERSLAFHAVGYGR
GSHIPAVVITSSGTAVSNLLPAVVEASQDFVPLILLTADRPPELLDCGANQAIDQVNHFG
SFVRFFFNLPAPTDQIPAKIVLTTLDSAVHRATTSPCGPVHINCPFREPLESSPLRWLSS
CLKGLNFWMTNADPFTKYIHMQLSHPCINAPGEMIEVLNLIQRANSGLLLFGAIHSEDEM
WAALLLAKHLQWPVVADILSGLRLRKLLTSFSDIERNFIFVDNLDHALLSDSVKSWLKID
VVIQIGSRITSKRICQILEECVPSSYIMVDRHPFRHDPSHIVTHRIQTTIFYFVGCLLEV
TFPHSRSIWSTSLRLLSKMVEWQIQFQITAESSLTEPYVAHVMSKALYPESALFLGNSMP
IRDVDMYGHSGPIHDHSVASLMLNSDLPLTLMRVAANRGASGIDGLLSTAIGFAVGCNKK
VFCVIGDISLLHDTNGLAILNQRKLRKPMTILVVNNHGGAIFSVLPLADKVERSILHQYF
YTSHNISIRELCLAHSIKHLHVKTKAELDEALCVAHHEQMDCMVEIESSIDANANFHSIL
KKNAFQTAQDTIRFLSVPFNQCSINDEFCIHKIHKIECSKYRFALSAPSTAASVGDNCKE
FYREGFILSVILEDGSVGFGEVAPLEIHKENLVDAEYQLRFLTHVMEQVDISSFLSLLKG
SFSYWIWNELGILPSSIFPSVRCGLEMAILNAIADSKGSNLLDILHPSTNENNKYERSSE
IQICALVDSNQSPAEVAKVAAALVKEGFSAIKLKVARGRDPVQDATLIQEVRKEVGCHIM
IRADANRNWTFEEAMKFGSLVKDCNLQYIEEPVQDEDDILKFCEESGLPVALDETIDKIQ
EHPLEKLVKFTHSGIVAVVIKPSVVGGFENAALIAQWAHQLGKMAVVSSAFESSLSLSAY
TQFSSYLDIQRSNTFKLFDVKEAPSVAHGLGTYRWLKEDITLDPLLIGRNPRSGLVEASV
ENASRLLSNFQVDQNVICNIIAEEKVCRYQLNVEHNNLSCSFEVCETGLKTNDNILVFLH
GFLGSGEDWITIMKTFSESARCISIDLPGHGKSILHGVKSASEEPSLSLEIIADILHKLT
HHVAPAKITLVGYSMGARIALYMALRFSSKIKGAVLISASPGLKDKLARKIRAAKDDSRA
CSVIAHGLQLFLSSWYAGELWKSLRSHPHFNRITASRLQHNDVHNLAQILSGLSIGRHPP
LWEDLPNCRVPLLIIHGEKDKKFKKIAQAMMNAINSCLGSKLEEVNDIHEVVEIPNCGHA
AHLENPLPLIAALRQFLTRL
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacctgtacctgctctccgatcttcacccttctacaacgcttcactctttctc
atcttcccacattcacattcacattcacattcatccacttcttcttcttcgcctttcgcc
attggagttactcgaacagtacttcccaaacttcacgttgtttcaggaggagtgagattt
gacgggtcattacctctaaacgacgacgacgaagttgttttcgagcactgcgttacacgg
actctgcctcccgcgcttacattggaagacggacttcacaaattgaaagatgctcttgag
attttgaaacttgctccgcctagttgtgagactggattccttaggtttcaggtgctggta
cctccgagttctaaggcattgagttggttttgctgtcaaccggagtcatcaggagtcttt
cctctgatttttgtttcgaaaaacatggatgatcccacgtgcaagtcactttatgtgaat
ggaagccgtggagtttttggcatcggtactgcagtttcttttgtacattcttcccctgga
aacaagagtttgatcaaaagatacatctcaactgattcaaccgatatagtggcctatggt
tttatggatattaatttagataatgattctgttagcattaatcacgaggatggttctttt
agctttttcatcccccagattgagttagatgagatggaaagtgtttctattctgacaatg
acacttgcatgggataacttttccctttctaattttgggaaagctcttcatttgctcgaa
gtttctctaaaccaggtcatatatcatgtctggtccacttccagcgctgagaaatccaaa
tgcgtaagagctgccctcagaaaactcaatttggtagaagatagatcgattccaagggtc
tacataaacactgttgcacggggtggaacagaaagtgtgggcgacatcatggaactgaaa
gagtctccatcttctagtcaattctgtgccaggctttcagcaaccctcactgtttcaaat
aacatgttggatcattccattgaattttcgcactcactgaacgaaagcgccaatatcaat
gctgtttgggcatcacttttagttgaagaatgtacacgacttggtttgacgtatttttgt
gtggcacctggatctagatcttccccacttgctgttgccgctgcaagtcaccaattaatt
acttgtatttcatgctttgatgaacgttcacttgcatttcatgctgttggatatggaaga
ggttctcacattccagcagtagtcataacatcatcaggcactgcagtttcaaaccttctt
ccagctgttgtggaggctagtcaagattttgtgccgcttattttacttacagctgatcga
cctccagagcttctggattgtggggcaaaccaagcaattgatcaggtgaaccattttggt
tcttttgtgagatttttctttaatctccctgcaccaacagatcagattcccgcaaagata
gtacttactactcttgattctgctgtacatcgggcaacaacttctccatgtggtcccgtg
catattaactgccctttccgagagcctttggaaagcagtcccctccgctggttatcaagc
tgtttaaaaggattaaacttctggatgactaatgctgacccatttaccaagtatattcat
atgcaattgtctcatccatgtataaatgctcctggtgaaatgattgaagttttaaatctg
attcaaagagccaacagtggtcttctactatttggtgcaatccattcagaggatgagatg
tgggctgctctgcttttagctaaacacctccagtggcctgttgtagcagatatcttgtca
gggttgcggttgagaaagcttttaacttctttttctgatattgaaagaaattttattttt
gtcgataatcttgatcatgctcttctctcagattctgtcaagagctggttgaagattgat
gtagttattcagataggaagcaggataaccagcaaacgaatctgtcaaattcttgaggaa
tgtgtcccttcttcatatattatggttgacaggcatccatttcgtcatgatccatcgcat
attgtaacccatcggatacaaactaccatcttttattttgtgggctgtttacttgaggtt
acttttccacattcaaggagcatatggagcacttccctacggttgctgagtaaaatggtt
gaatggcagatacaatttcagatcactgctgagtcctccctaactgaaccttatgttgca
catgtgatgtcaaaagctctttaccctgaatctgctcttttcctgggtaacagtatgcct
attcgtgatgtagatatgtatggacatagtggacccatacatgatcatagtgttgcatct
cttatgctaaattcagacctaccacttaccttgatgagagtagctgctaacaggggagct
agtggtattgatgggttactcagcacggccattggttttgctgtaggatgcaacaaaaag
gtgttctgtgtaattggagatatttcattgttgcatgatacaaacggtctggcaattttg
aaccagcggaaattgcggaaaccaatgacaattcttgtggttaataaccacggaggtgca
attttcagtgttcttcctttggcagataaagttgaacgaagtatactgcatcaatatttc
tacacctctcacaacatttcaatccgtgagctatgcttggcacatagtatcaaacattta
catgtgaagacaaaggcggaactcgatgaagctctgtgtgtagctcatcatgaacagatg
gattgtatggttgaaattgagagttccattgatgccaatgccaattttcacagtattttg
aaaaaaaatgctttccaaactgcacaagacaccataagattcctctcggttcctttcaat
caatgctctataaacgatgagttctgtatacacaaaattcataaaatagagtgttcaaaa
tatagatttgcattaagcgccccatcaacagcagcatctgttggtgataattgtaaagaa
ttttatagagaaggatttattttatcggtaattcttgaagatggaagtgttggttttggg
gaggttgcaccccttgagatccacaaagaaaatcttgtagatgctgaatatcaacttagg
tttcttacacatgtcatggaacaagtagatattagtagcttcctctctctattgaagggc
tcattttcatattggatatggaatgagttgggcattttgccatcttcaatttttcctagt
gtaagatgtggtttggaaatggctatcctcaatgccatagcggattcaaaaggctctaac
ttgttggacatactccatccctcaacaaatgaaaacaacaaatatgaaaggtcatcagaa
attcagatttgtgcgctagttgattcaaatcaatctccagccgaagtagctaaagttgca
gccgcactagtcaaggaaggattttctgcaattaagctgaaggtagcacgtggtcgggat
ccagtgcaagatgccacattaatacaagaagtaagaaaggaagttggttgccacattatg
atccgtgcagatgcaaatcgaaactggacttttgaggaagctatgaaatttggctctttg
gttaaggattgtaacctgcagtatatcgaggaacctgttcaggatgaagatgatattctc
aagttctgtgaagaaagcggattacctgttgccctagatgaaaccatagataaaattcaa
gaacatcccctggaaaagctagtgaagtttacccattcaggaatagttgctgttgttatt
aagccaagtgttgttggtggatttgagaatgcagcattaattgcacaatgggcgcaccaa
ctcgggaagatggctgttgtcagttctgcatttgaaagcagtttgagtctgtcggcatat
actcagttttctagttatcttgacatacagagatcaaatacattcaaattgttcgatgtt
aaggaagcaccttctgtagctcatggtctaggaacctatcgttggcttaaagaagacata
acgcttgatcctcttttgattggtcgtaatccacgtagtggtttggtcgaagcatctgtg
gaaaacgctagtcggttgctaagtaactttcaagtcgaccagaatgtcatctgcaatatt
atagctgaggagaaagtttgtcggtatcaattgaatgtagagcataacaatttatcgtgt
tcttttgaagtttgtgagactggtcttaaaacaaatgataatatactagtatttcttcat
ggttttcttggaagtggtgaagactggattactatcatgaagaccttttctgaatcagca
agatgcatttcaattgaccttcctggtcatggaaaatcaatattacatggtgtaaaaagt
gcttctgaggaaccatcgttgtcgctggagataattgctgatatattacataaactaact
catcatgtagcaccagctaaaattacactagttgggtattcaatgggagcaaggatcgca
ttgtatatggcactgagatttagcagcaagataaagggagctgtgttgatatctgcaagc
cctggactaaaagataaattggcaagaaaaatccgtgcagctaaagatgattccagagca
tgctctgtcattgcacatggtttacagctttttctcagctcctggtatgctggagagctg
tggaaaagcttaagaagccatcctcatttcaatcgaatcactgccagtcgcttgcagcat
aatgatgtacacaatcttgcacagatcctgtctggattaagcataggaaggcatccgcct
ttgtgggaagatttgccgaattgtagagtacctcttcttatcatacacggagagaaggat
aagaaatttaagaaaattgctcaagcaatgatgaatgcaataaactcttgcctggggagt
aaacttgaagaagtgaatgacatacacgaggttgttgagattcctaactgtgggcatgct
gcccatttggagaatcctcttcctctcattgctgccttgagacaattcctcacaagacta
tag

DBGET integrated database retrieval system