KEGG   Medicago truncatula (barrel medic): MTR_8g080240Help
Entry
MTR_8g080240      CDS       T01716                                 

Definition
(GenBank) pre-mRNA splicing factor ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MTR_8g080240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mtr03041]
    MTR_8g080240
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MTR_8g080240
Spliceosome [BR:mtr03041]
 Complex C
  Other components
   Step II factors
    MTR_8g080240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 AAA_19 DUF2075 ABC_tran cobW Helicase_RecD AAA_29 AAA_23 PhoH SRP54 AAA_14 T2SSE ATPase_2 FtsK_SpoIIIE RsgA_GTPase AAA_16 SMC_N
Motif
Other DBs
NCBI-ProteinID: KEH20562
UniProt: A0A072TT13
Position
8
AA seq 697 aa AA seqDB search
MATLPIVQYEEKIIETVENNSITVIIGETGSGKSTQLSQMLHRRGYSKIAVTQPRRVAAV
SVSRRVAQELGVQLGEEVGYAIRFEDRTSRNTRIKYLTDGVLLRESLADPELNDYSVIIL
DEAHERSLNTDILMGLMKRLVKIRSSNLKVLITSATLDGDKVSKFFRDCPVLNIPGKLYP
VEVLYSKERPVNYLDAALKTALDIHIRQPEGDILIFMTGQDDIEKLVMKMEEKVRALDEG
SCMDAIIFPLHGSLPPELQVRVFSPPPPNCRRIIVATNIAETSLTVDGVVYVIDSGYVKQ
RQYNPSSRMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSQIYHDEFLDVTVPEIQR
SSLAGSVLYLKSLDLPDIDILKFDFLDSPSPESLRDALKQLYLIDAIDENGSITSVGRKM
AELPLEPSLSRTLMEANNHGCITEALTVAAMLSSETALLPGQSKTEKKRKRPISNLPDGS
GLGDHIQLLQIFERWHQTDYDIGWCKDHGLQVRGMSFARDVRKQLSQIMQKIAKEPLGIR
TNGKGEEIRRDYRNLRKALCVGYANQLAERKMHHNGYRTLGFQGQVVQVHPSSALSSDEF
GKFPDYVVYHELIATPRPFMRNVCSVEMKWVIPIINKLNTLNVYKLSGGGMDHFEEESER
NIPNLPKKNVEVAAAADDSQSRIQAARERFLARKVNK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggctacccttccgattgtccaatacgaagaaaagataatcgaaaccgtagaaaacaac
tccatcaccgtcatcatcggcgaaactggttccggtaagagcactcaactctctcagatg
cttcaccgccgcggttactccaaaatcgccgtcactcaacctcgccgtgtcgctgccgtc
tccgtctctagacgagttgctcaagagctcggtgttcagcttggagaagaagtaggttac
gccattcgattcgaagatagaacttcacgcaacacgcgcattaagtacctaactgatggt
gttcttctccgtgaaagtctagctgatcctgaactaaatgattattctgttatcatattg
gatgaagctcatgaaaggagtttgaacacagatatattaatggggcttatgaaacgtttg
gtgaaaattcgttcctccaatctcaaagtgttgatcacatctgctacgcttgatggtgat
aaagtatcgaagttctttcgagattgccctgtattgaacatccctgggaagttgtatcct
gttgaggttctttatagcaaggagcggcctgtgaactatctcgatgcagctcttaaaaca
gctcttgatatacatatacgtcaaccggaaggggatattttgatattcatgactggacag
gatgacatagagaagttggtaatgaaaatggaagaaaaagtccgtgctctcgacgaaggt
tcctgcatggatgctataatctttcctctacatggttctttgccacctgaattgcaggtg
cgtgtatttagtcctccacctccaaattgcagacgaatcattgttgctacaaatattgct
gaaacttctttgactgttgatggtgtagtgtatgttattgactctgggtatgtaaagcag
aggcagtacaatccatctagtaggatgtattcccttgatgttgttcaaattagcaaagtg
caagctaatcagcgggcaggcagagctggacgaacacgaccagggaaatgctaccgtcta
tatccttcccaaatctaccatgatgagtttttggacgttacagttcctgaaattcagaga
tcttctcttgccggcagtgtgctttacttgaagtcattggacctccctgatattgacatt
ctcaaatttgacttccttgattctccgtcacctgaatccttacgagatgccttgaagcaa
ttatatctgattgacgctattgatgaaaatggttcaattacaagtgtcggaagaaaaatg
gctgagcttccgttagaaccatccctgtcaagaactttaatggaagcaaacaatcatggt
tgtataactgaggctttgactgttgctgccatgttatcatctgaaactgcattgctacca
gggcagagcaaaactgagaaaaagaggaaacgtccaatatctaaccttcctgatggttct
ggcttgggtgaccacatccaattactgcagatattcgagcgttggcatcaaactgattat
gacattggttggtgcaaagatcatggcttgcaggtgcgaggaatgtcgtttgccagagat
gtccgtaagcagttatctcagataatgcagaaaatcgctaaggaaccgttgggtataaga
acaaatgggaaaggggaagagatccggagggattatcgaaatttgaggaaggctttatgc
gtgggctatgcgaatcagctggctgaaagaaagatgcatcataatggttatcgaacccta
ggtttccaaggccaagtagtccaggtacatccatcatctgcattgagctctgatgaattt
gggaagtttccagactatgttgtataccatgagctaattgcaacaccacgaccattcatg
agaaatgtatgttctgttgagatgaaatgggttatacccattattaacaagcttaatacc
ttaaatgtgtacaaattaagtggtggtggcatggatcattttgaggaggaatctgagaga
aatattccaaatttgcccaagaagaatgttgaggttgctgctgctgcagacgatagtcaa
agtagaatccaagccgccagagaacgatttcttgctcgaaaagtcaataagtga

DBGET integrated database retrieval system