KEGG   Microbacterium testaceum: MTES_0123Help
Entry
MTES_0123         CDS       T01423                                 

Gene name
pycA
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00020  Citrate cycle (TCA cycle)
mts00620  Pyruvate metabolism
mts01100  Metabolic pathways
mts01120  Microbial metabolism in diverse environments
mts01200  Carbon metabolism
mts01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTES_0123 (pycA)
   00620 Pyruvate metabolism
    MTES_0123 (pycA)
Enzymes [BR:mts01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MTES_0123 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_D23 RnfC_N GCV_H acVLRF1 HlyD_2
Motif
Other DBs
NCBI-ProteinID: BAJ73087
UniProt: E8N867
Position
complement(118063..121470)
Genome map
AA seq 1135 aa AA seqDB search
MFSKILVANRGEIAIRAFRAAYEVGARTVAVYPYEDRSSLHRLKADEAYQIGERGHPVRA
YLDVDEIIRVARECGADAIYPGYGFLSENPELAEKAAANGITFIGPPAEVLSMAGNKVTA
KEHAIAAGVPVLRSTPASDDIDALLAQAEEIGFPLFAKAVAGGGGRGMRRVESLGELAPA
LAEAMREAQSAFGDPRMFLEQAVQRPRHVEVQILADATGETVHLFERDCSVQRRHQKVIE
IAPAPNLDDAVRQDLHRYAVAFARSIGYQNAGTVEFLLETAGPRAGEVVFIEMNPRIQVE
HTVTEEVTDVDLVQSQMRIAAGQTLADLHLQQDDIHLRGAALQCRITTEDPTQGFRPDTG
KITTYRSPGGAGIRLDGGTTAAGSQVSPHFDSMLSKLSCRGRDFPAAVARARRALAEFRI
RGVSTNIPFLQAVLDDPAFVAGDLSTSFIDERPELLKGRESKDRGTKILSWLVDTTVNRP
NGENPLSVDPGAKLPALDLVAPAPAGSRQLLRELGPAGFVKALREQTALAVTETTFRDAH
QSLLATRVRTRDLVRVAPYVARMTPGLLSVEAWGGATYDVALRFLGEDPWERLDALREAL
PNVAIQMLLRGRNTVGYTPYPTEVTDAFVAEAAASGVDIFRIFDALNDVAQMRPAIDAVL
SSGTAVAEVALCYTGDLLDPAENLYTLDYYLGLAEQIVDAGAHVLAIKDMAGLLRPAAAA
KLVTALRDRFDLPVHVHTHDTAGGQLATLLAASAAGADAVDAAAAPMAGTTSQPSLSALV
AALAHTERDTGLDLAAVSDLEPYWEAVRHLYRPFESGLAGPTGRVYRHEIPGGQLSNLRQ
QAIALGLADDFELIEDMYAAADRILGRVPKVTPSSKVVGDLALHLAAVKADPADFEQNPE
KYDVPDSVVSFMAGELGDLPGGWPEPFRSKVLAGRDAKIGVTPLSDDDTTALAGESAERR
ARLNRLLFPGPTRTFEETREAYGDLSVLDTADYLYGLRAGGEHTVEIERGVQLFVGLEAV
GEADDKGMRTVMTTLNGQLRPVFVRDRSIDVEARQAEKADTSKPGQVAAPFSGVVTLKVA
PGDRVTAGQAVASIEAMKMEAGIASQIDGVVERVAIVTTQQVEAGDLLLVIRPAQ
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgaagatcctggtcgccaatcgcggagagatcgccatccgggcgttccgtgcc
gcctacgaagtcggtgcgcgcaccgtcgccgtctacccgtacgaagatcgttcgtctctg
caccggctcaaagccgacgaggcgtaccagatcggcgagcgcgggcaccccgtgcgcgcg
tacctcgacgtcgacgagatcatccgcgtcgcccgggaatgcggggcggatgccatctac
cccggctacggcttcctgtcggagaacccggaactcgccgagaaggccgccgcgaacggc
atcaccttcatcggcccgcccgccgaggtgctgtcgatggccggcaacaaggtcacggcc
aaggagcacgcgatcgccgcgggcgtgccggtcctgcgctcgacccccgcgtccgacgac
atcgacgccttgctggcccaggccgaggagatcggcttcccgctcttcgccaaggccgtg
gccggcggcgggggacgcgggatgcgccgcgtcgagagcctcggcgagctcgccccggcc
ctggccgaggcgatgcgcgaggcgcagagcgccttcggcgacccgcgcatgttcctcgag
caggcggtgcagcgtccccgtcacgtcgaggtgcagatcctcgcggatgccacgggcgag
acggtgcacctcttcgagcgcgactgctcggtgcagcggcgccaccagaaggtcatcgag
atcgccccggcgccgaacctcgacgacgccgtgcggcaggacctccaccgctacgccgtc
gcgttcgcccggtcgatcggttaccagaacgccggaacggtcgagttcctcctcgagacg
gccggcccccgcgcgggcgaggtcgtcttcatcgagatgaacccgcgcatccaggtcgag
cacaccgtgaccgaggaggtcaccgacgtcgacctcgtccagtcgcagatgcgcatcgcg
gcgggccagacgctcgccgacctgcacctgcagcaggatgacatccacctgcgcggagcg
gccctgcaatgccgcatcaccaccgaggacccgacgcagggtttccgccccgacacgggg
aagatcaccacgtaccgctcgccgggcggagccggcatccgtctcgacggcggcaccacg
gcagccggttcgcaggtcagccctcacttcgactcgatgctgtcgaagctgtcgtgtcgc
gggcgcgacttccccgcggcggtcgctcgcgcgcggcgcgcgctggcggaattccgcatc
cgcggcgtctcgacgaacatcccgttcctgcaggcggtgctcgatgacccggccttcgtc
gccggcgacctcagcacgtcgttcatcgacgagcgccccgaactgctcaagggccgcgag
tcgaaggaccgcggtacgaagatcctgtcgtggctcgtcgacaccacggtcaaccgtccg
aacggcgagaacccgctgtcggtcgacccgggcgccaagctccccgcgctcgacctcgtc
gcgccggcccccgcaggatcgcgtcagctcctgcgagagctcggacccgcgggcttcgtg
aaggctctccgcgagcagaccgccctcgcggtcaccgagaccacgttccgcgacgcccac
cagtcgctgctcgcgacgcgcgtccgcacgcgcgacctcgtccgcgtcgcaccgtacgtg
gcccgcatgacccccggcctgctctcggtcgaggcatggggtggggcgacgtacgacgtc
gccctgcgcttcctcggcgaggacccgtgggagcgactcgacgcgctgcgcgaggccctg
ccgaacgtcgcgatccagatgcttctccgcgggcgcaacaccgtgggttacaccccgtac
cccacggaggtgacggatgccttcgtcgccgaggctgcggcatccggggtcgacatcttc
cgcatcttcgacgccctcaacgacgtcgcgcagatgcggcccgcgatcgacgccgtgttg
agctccggtaccgctgtcgcggaggttgcgctctgctacaccggcgacctcctcgacccg
gcggagaacctctacacgctcgactactacctcggtctcgccgagcagatcgtcgacgcg
ggcgcgcacgtgctcgcgatcaaggacatggcgggtctgctgcgcccggcggctgccgcg
aagctcgtcacggcgctgcgcgatcgcttcgacctgccggtgcacgtgcacacgcacgac
accgcgggagggcagctcgcgacgctcctggccgcctcggcggcgggggcggatgccgtt
gacgcggccgccgcgcccatggcgggcaccacgagccagccgtcgctgtcggccctcgtc
gccgccctcgcgcacaccgagcgcgacaccggtctcgacctggccgccgtcagcgacctg
gagccgtactgggaggccgtgcgccacctctaccgtccgttcgagtccgggctcgcgggc
ccgacaggtcgcgtgtaccgtcacgagatcccgggtggccagctgtcgaacctgcggcag
caggccatcgcgctggggctcgccgacgatttcgagctcatcgaggacatgtacgctgcg
gcggaccgcatcctcggtcgcgtgccgaaggtgacgccgtcgtccaaggtcgtcggcgat
ctcgccctgcacctcgcggcggtcaaggccgacccggccgacttcgagcagaaccccgag
aagtacgacgtgcccgactcggtcgtgtcgttcatggcgggcgagctcggcgatctgccg
ggcggttggccggagccgttccgctcgaaggtgctggccggacgcgacgcgaagatcggt
gtgaccccgctcagcgacgacgacaccacggcgctggcgggggagtccgccgagcgtcgt
gcgcgtctgaaccgcctgctcttcccggggccgacccggacgttcgaggagacgagggag
gcctacggcgatctcagcgtcctcgacacggccgactacctctacgggcttcgtgcgggt
ggggagcacacggtcgagatcgagcgtggcgtgcagctcttcgtcgggctcgaggccgtc
ggcgaggccgacgacaagggcatgaggacggtcatgaccaccctcaacggtcagttgcgc
ccggtgttcgtgcgcgatcgctcgatcgacgtcgaggcccgccaggcggagaaggcggac
acctccaagcccggtcaggtcgccgcgccgttctcgggggtcgtgacgctcaaggtcgcc
ccgggcgaccgggtcacggccggtcaggcggtggcatccatcgaggcgatgaagatggag
gcggggatcgcgtcgcagatcgacggcgtcgtcgagcgtgtcgcaatcgttaccacacag
caggtggaagcgggagaccttttgctggtaatccgccccgcgcagtaa

DBGET integrated database retrieval system