KEGG   Microbacterium testaceum: MTES_0221Help
Entry
MTES_0221         CDS       T01423                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mts  Microbacterium testaceum
Pathway
mts00010  Glycolysis / Gluconeogenesis
mts00020  Citrate cycle (TCA cycle)
mts00620  Pyruvate metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01130  Biosynthesis of antibiotics
mts01200  Carbon metabolism
Module
mts_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_0221
   00020 Citrate cycle (TCA cycle)
    MTES_0221
   00620 Pyruvate metabolism
    MTES_0221
Enzymes [BR:mts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MTES_0221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: BAJ73185
UniProt: E8N8X6
Position
222239..223429
Genome map
AA seq 396 aa AA seqDB search
MIDILMPRLSDTMTEGAIAVWRKKPGDPVAPGDVLLEIETDKALMEQEAYDAGTLVEILV
PEGENVAIGTPIARLDDGKEPAPLASSERADLPAPAAPRAPEPDATPPAPPHGRATPLVR
RLAKEQGIDLSSLTGSGPGGRIVRADLDAAAEAPASPVPSGEGAESPADITRIPFDGIRR
AIATRLSDSAATIPVFHATAAADVTDLLALRTQLNAVGDTRISVNDLVVKAVALALRDHP
GINAAYSPDDGGQTVIHHGIHVGVAVAAPSGLVVPVVRDADRSSISTIARRTRELADRAA
ARTLTVDEMNGGTFTVSNLGMFGVEHFTAIINPPQGAILAVGGITDELALVDEGVVARRR
LRVTLTCDHRIIDGAAAGRFLAGLTAVLEAPLRVLT
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcctcatgccgcgcctgtccgacaccatgacggaaggcgcgatcgccgtc
tggcggaagaagcccggcgatcccgtcgcccccggggacgtgctcctcgagatcgagacc
gacaaagccctcatggagcaggaggcctacgacgccggcaccctcgtcgagatcctcgtc
cccgagggagagaacgtcgcgatcggcacccccatcgcacggctggacgacgggaaggag
cccgctccgctcgcgtcgtccgagcgcgcggacctcccggcgcccgcagcgccacgggct
ccggaaccggatgccacgccgcccgcgcccccgcacggtcgggccaccccgctggtccgg
cgtctcgccaaggaacagggcatcgatctgtcgtcgctcacgggatccggtccgggcgga
cgcatcgtgcgcgccgatctcgacgccgcggccgaggcaccggcatcccccgttccgtcc
ggcgagggtgcggagtcgcccgccgacatcacgcgcatccccttcgacggcatccgccgg
gcgatcgcgacacgtctcagcgacagcgccgcgacgatcccggtgttccacgccaccgcc
gcggccgacgtcaccgatctgctcgcactgcgcacccagctcaatgcggtgggagacacg
cggatctcggtcaacgatctcgtcgtgaaagccgtcgcgctcgccctccgcgaccacccc
gggatcaacgccgcgtactcgcccgacgacggcgggcagaccgtcatccaccacggcatc
cacgtcggtgtcgccgtcgccgccccctcgggcctcgtggtgcccgtcgtccgcgacgcc
gaccgctcgagcatctccacgatcgcgcgacggacccgcgagctcgccgaccgcgccgcc
gcacgcaccctcaccgtcgacgagatgaacggcggcaccttcaccgtcagcaatctcggc
atgttcggcgtcgagcacttcaccgccatcatcaacccgccgcagggcgcgatcctcgcc
gtgggtggcatcaccgacgagctcgccctcgtcgacgagggcgtggtcgcgcgtcgccgc
ctgcgcgtcacgctcacctgcgaccatcgcatcatcgacggcgccgcggcggggcggttc
ctcgccgggctgacggcggtgctggaggcgccgttgcgggtgctcacgtga

DBGET integrated database retrieval system