KEGG   Microbacterium testaceum: MTES_0357Help
Entry
MTES_0357         CDS       T01423                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mts  Microbacterium testaceum
Pathway
mts00010  Glycolysis / Gluconeogenesis
mts00030  Pentose phosphate pathway
mts00051  Fructose and mannose metabolism
mts00052  Galactose metabolism
mts00680  Methane metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_0357 (pfkA)
   00030 Pentose phosphate pathway
    MTES_0357 (pfkA)
   00051 Fructose and mannose metabolism
    MTES_0357 (pfkA)
   00052 Galactose metabolism
    MTES_0357 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MTES_0357 (pfkA)
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MTES_0357 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MTES_0357 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase UPF0261
Motif
Other DBs
NCBI-ProteinID: BAJ73321
UniProt: E8NA87
Position
complement(360358..361386)
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGVVLKGTTNYDIEFVGIRDGWRGVVDGDFFPLTRHEVKGL
SKVGGTILGTSRTNPYEGVRGGAENISKTLYGHRIDGILAIGGEGTLAAADRLSKDGINV
LGVPKTIDNDLRATDYSFGFDTAVNIATDAMDRLRTTGDSHQRCMVAEVMGRHVGWIALH
AGIAAGAHVICIPEVPMSIDEIVEQVTRAHDRGRAPLVVVSEGFKLTGMDEAFSDKGLDA
FNRPRLGGIGELLAPEIERLTGIETRSTVLGHIQRGGSPSAFDRVLATRLGLHAADALHE
GAWGQMVAMRGTDIVRVPFADALGELNSVPLYRYEEAAALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcatcctgaccagcggcggcgactgccccggtctcaacgcggtcatccgt
ggcgtcgtgctgaagggcacgaccaactacgacatcgagttcgtcggcatccgtgacgga
tggcgcggcgtggtcgacggcgacttcttccccctcacgcgccacgaggtgaaggggctg
tcgaaggtcggcggcaccatcctcggcacgagccggaccaacccctacgagggcgtgcgc
ggcggcgccgagaacatctcgaagacgctctacgggcaccggatcgacggcatcctggcc
atcggcggcgagggtaccctcgccgcggccgaccgtctgtcgaaggacggcatcaacgtc
ctcggcgtgccgaagacgatcgacaacgacctgcgcgccaccgactactcgttcggattc
gacaccgccgtcaacatcgcgacggatgccatggaccgcctccgcacgaccggcgactcg
caccagcgctgcatggtcgccgaggtcatggggcgccacgtcggctggatcgcgctccac
gccgggatcgccgcgggcgcccacgtcatctgcatccccgaggtgccgatgtcgatcgat
gagatcgtcgagcaggtcacccgcgcccacgaccgcggtcgcgcgcctctggtcgtcgtg
tccgagggcttcaagctcaccggcatggacgaggccttcagcgacaagggcctggatgcc
ttcaaccgtccccgcctcggcggcatcggcgagctcctcgcccccgagatcgagcgcctc
accggcatcgagacccgctcgacggtcctcggccacatccagcgcggcggctcgccgtcg
gcgttcgaccgcgtcctcgcgacgcgcctcggcctccacgccgccgacgccctgcacgag
ggagcctgggggcagatggtcgcgatgcgcggcaccgacatcgtgcgcgtccccttcgcc
gacgcgctcggcgagctcaacagcgtgccgctgtaccgctacgaggaggccgccgccctg
ttcggctga

DBGET integrated database retrieval system