KEGG   Microbacterium testaceum: MTES_1564Help
Entry
MTES_1564         CDS       T01423                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
mts  Microbacterium testaceum
Pathway
mts00740  Riboflavin metabolism
mts00790  Folate biosynthesis
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MTES_1564 (ribA)
   00790 Folate biosynthesis
    MTES_1564 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MTES_1564 (ribA)
Enzymes [BR:mts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     MTES_1564 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: BAJ74528
UniProt: E8N9Q9
Position
1661510..1662148
Genome map
AA seq 212 aa AA seqDB search
MNAAVSLLPRAEVRTEVRIPLRFADGFETTARVSTFRHLVDGAEHLLLSFDGTAPSDDAP
LVRLHSECLTGDVFGSERCDCGPQLREAVERLSIEGGALLYLRQEGRGIGLYAKLDAYAL
QDAGLDTYEANTALGHGEDERDYTAAAQMLDAVGVRGIRLLTNNPDKVAQLTALGITVHG
VVPTGVHLTAANARYLQAKRDHTGHHLDLGVA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggcggtctcgctcctcccacgcgcggaggtccgcaccgaggtgcgcatcccg
ctgcgcttcgccgatggcttcgagaccacggcgcgagtgtcgactttccgtcacctcgtc
gacggcgccgagcacctgctcctgtcgttcgacgggaccgcaccgagcgacgacgctccc
ctggtgcggctgcacagcgaatgcctcaccggcgacgtgttcggttcggagcgatgcgac
tgcggcccgcagctgcgcgaggccgttgagcggctgtcgatcgagggtggcgcgctgctc
tacctgcggcaggaaggccgtggcatcgggctgtacgcgaagctcgacgcgtacgcgttg
caggatgccggactcgacacctacgaggcgaacaccgccctggggcacggggaagacgaa
cgcgattacaccgcggccgcgcagatgctcgatgcggtcggggtgcgtggcatccggctt
ctgacgaacaatcccgacaaggtcgcgcagctgaccgcgctcgggatcaccgtccatggc
gtcgtgccgaccggagtgcacctgacggcggcgaacgctcgctatctgcaggcgaagcgc
gatcacaccggccaccacctcgacctcggggtagcgtga

DBGET integrated database retrieval system