KEGG   Microbacterium testaceum: MTES_1885Help
Entry
MTES_1885         CDS       T01423                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mts  Microbacterium testaceum
Pathway
mts00071  Fatty acid degradation
mts00280  Valine, leucine and isoleucine degradation
mts00281  Geraniol degradation
mts00310  Lysine degradation
mts00360  Phenylalanine metabolism
mts00362  Benzoate degradation
mts00380  Tryptophan metabolism
mts00410  beta-Alanine metabolism
mts00627  Aminobenzoate degradation
mts00640  Propanoate metabolism
mts00650  Butanoate metabolism
mts00903  Limonene and pinene degradation
mts00930  Caprolactam degradation
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01130  Biosynthesis of antibiotics
mts01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MTES_1885
   00650 Butanoate metabolism
    MTES_1885
  Lipid metabolism
   00071 Fatty acid degradation
    MTES_1885
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTES_1885
   00310 Lysine degradation
    MTES_1885
   00360 Phenylalanine metabolism
    MTES_1885
   00380 Tryptophan metabolism
    MTES_1885
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTES_1885
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MTES_1885
   00281 Geraniol degradation
    MTES_1885
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MTES_1885
   00627 Aminobenzoate degradation
    MTES_1885
   00930 Caprolactam degradation
    MTES_1885
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MTES_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: BAJ74849
UniProt: E8NCI0
Position
2010299..2011363
Genome map
AA seq 354 aa AA seqDB search
MNAQRADDDPVWAEALRGVGHLTLNRPRAINALGLDMIRDLAAALDRWQDDTDIELILLD
GAGERGFCAGGDVRALHGLVVEGRVDEVHTYFREEYALDHLIATYPKPVVAIADGVTMGG
GIGLAGHAAIRIVTENSLLAMPETRIGFTPDVGGSWLLSRAPGRLGEYLGLTGATMDAAD
AIYAGFADHLVPTAHLPALYDAFQVRADPASPTELVLLFDETAGPSRLEAARPWIDDAFA
ADDVHGILERLRARPEAEAHETAELLAASAPTAVAVTLAAVRRARTLPDLRAALAQEYGL
VMWFAQTQPDLVEGIRAQLIDKDRSPTWSPGRHEDLGPEVVASALAHEPATPLW
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctcagcgagccgacgacgaccccgtgtgggcggaagccctccgcggtgtcggg
catctgaccctcaaccgaccgcgggccatcaacgccctcgggctcgacatgatccgcgac
ctcgccgcggccctcgaccggtggcaggacgacaccgacatcgagctgatcctgctcgac
ggagccggcgagcggggcttctgcgcgggcggcgatgtccgcgcgctgcacgggcttgtc
gtggagggccgggtcgacgaggtgcacacctacttccgcgaggagtacgcgctcgaccac
ctcatcgcgacctacccgaagcccgtcgtcgcgatcgcggacggggtgaccatgggcggc
ggcatcggcctcgcgggtcacgccgcgatccgcatcgtcaccgagaactcgcttctcgcg
atgcccgagacccgcatcggcttcacccccgacgtgggcggctcctggctgctctcccgc
gcgcccggccggctgggcgaatacctcgggctgaccggggcgacgatggatgccgccgac
gcgatctacgcgggattcgccgaccacctggtgcccacggcccacctgccggctctttac
gacgcgttccaggtgcgggcggatccggcgagtcccaccgagctggtgctgctgttcgac
gagactgcgggcccctcccgcctggaggctgcgcgaccgtggatcgatgacgcgttcgcc
gccgatgacgtccacggcatcctggagcgcctccgcgcgcgtcccgaggccgaggcgcac
gagacggctgagctgctggccgcatccgcgccgacggccgtcgcggtgacgctcgccgcc
gtccgccgggcgcggacgctcccggatctgcgggccgcgctcgcgcaggagtacggtctg
gtcatgtggttcgcccagacccagcccgacctggtcgagggcatccgcgcgcagctcatc
gacaaggaccggtcaccgacgtggtcgccggggcggcacgaggacctcgggcccgaggtc
gtggcatccgccctcgcccacgaacccgcgacgccgctctggtga

DBGET integrated database retrieval system