KEGG   Microbacterium testaceum: MTES_1914Help
Entry
MTES_1914         CDS       T01423                                 

Definition
(GenBank) beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mts  Microbacterium testaceum
Pathway
mts00010  Glycolysis / Gluconeogenesis
mts00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_1914
   00500 Starch and sucrose metabolism
    MTES_1914
Enzymes [BR:mts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MTES_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: BAJ74878
UniProt: E8NCK9
Position
complement(2039241..2040656)
Genome map
AA seq 471 aa AA seqDB search
MSNTPFPHGFLWGGATAANQIEGAYDEDGKGLSVQDVMPRGISGPRSETPTPDNLKLVGI
DHYHRYAEDIALFAEMGFGVYRFSIAWSRIFPNGDETEPNEAGLAFYDRVLDELEKHGIE
PLVTISHYETPLHLAEQYGGWTNRELIGFYERYARTLFERFGARVKYWLTFNEINSLLHA
PFMSGGIPIPEGGVPEEQLYQAMHHELVASARATRIAREVAPEAKIGCMVLSMPVYPLSP
SPDDALAVMDADHGNLVYGDVHARGTYPGYFLRTLRAKGITLDISDQDRDDLTNTVDFVS
FSYYMSIAETADPAKKVAGEGNIMGGVSNPTLPASEWGWQIDPVGLRLVLNQFWDRWQKP
LFIVENGLGARDQLVEIDGEKTVVDDYRIAYLNDHLVQVGEAIEDGVDVLGYTSWGCIDI
VSASTAQLSKRYGFIYVDRNDDGTGTLERYRKKSFGWYADVIRSNGASLTR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacccccttcccccacggcttcctctggggcggcgcgaccgccgccaaccag
atcgagggcgcgtacgacgaagacggcaagggcctgtcggtgcaggacgtgatgcctcgc
ggcatctcgggcccgcgatcggagacgcccacccccgacaacctcaagctcgtcggcatc
gaccactaccaccgctacgcggaggacatcgcgctgttcgcggagatgggattcggggtc
taccgtttctcgatcgcgtggagccgcatcttcccgaacggcgatgagaccgagcccaac
gaagcgggtctggcgttctacgaccgcgtgctcgacgagctcgagaaacacggcatcgag
ccgctcgtgacgatctcgcactacgagaccccgctgcacctcgcggagcagtacggcggc
tggaccaaccgcgagctcatcgggttctacgagcgctacgcgcgcacgctcttcgagcgt
ttcggcgcgcgggtgaagtactggctgaccttcaacgagatcaactcgctcctgcacgcg
ccgttcatgagcggcggcatcccgatccccgagggcggcgttcccgaggagcagctgtac
caggcgatgcaccacgagctcgtggcatccgcccgcgccacgcggatcgcccgcgaggtg
gctcccgaggcgaagatcggctgcatggtgctgtcgatgcccgtgtacccgctgagcccc
tcgcccgacgacgccctcgcggtgatggatgccgaccacggcaacctcgtctacggcgac
gtccacgcgcgcggcacgtaccccgggtacttcctgcgcacgctgcgggcgaagggcatc
acgctcgacatcagcgatcaggaccgcgacgacctgacgaacaccgtcgacttcgtgtcg
ttcagctactacatgtcgatcgccgagaccgccgacccggcgaagaaagtcgcgggcgag
ggcaacatcatgggaggtgtgtcgaacccgacgctgcccgcgagcgagtggggctggcag
atcgaccccgtgggcctgcgcctggtgctgaaccagttctgggaccgctggcagaagccg
ctcttcatcgtcgagaacgggctgggcgcgcgcgaccagctcgtcgagatcgacggagag
aagacggtcgtcgacgactaccgcatcgcctacctgaatgaccacctcgtgcaggtcggt
gaggcgatcgaggacggcgtcgacgtgctcggctacacctcgtggggctgcatcgacatc
gtcagcgccagcaccgcgcagctcagcaagcgatacggtttcatctacgtcgaccgaaac
gacgacggcaccggaacgctcgagcgctaccggaagaagtcgttcggctggtacgccgac
gtcatccgatccaacggcgcgtccctgacccgctga

DBGET integrated database retrieval system