KEGG   Microbacterium testaceum: MTES_2014Help
Entry
MTES_2014         CDS       T01423                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00010  Glycolysis / Gluconeogenesis
mts00051  Fructose and mannose metabolism
mts00562  Inositol phosphate metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01130  Biosynthesis of antibiotics
mts01200  Carbon metabolism
mts01230  Biosynthesis of amino acids
Module
mts_M00002  Glycolysis, core module involving three-carbon compounds
mts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_2014
   00051 Fructose and mannose metabolism
    MTES_2014
   00562 Inositol phosphate metabolism
    MTES_2014
Enzymes [BR:mts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MTES_2014
Exosome [BR:mts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MTES_2014
  Exosomal proteins of bladder cancer cells
   MTES_2014
  Exosomal proteins of melanoma cells
   MTES_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TetR_C_6
Motif
Other DBs
NCBI-ProteinID: BAJ74978
UniProt: E8NDC0
Position
complement(2159833..2160600)
Genome map
AA seq 255 aa AA seqDB search
MTAPVWVGVSLKTYFGHSRALAWLREVAGVVRDTPAVASGAVRLVVVPTYLQIPAALEAF
AGTGVLIGAQDVSAHPGGAFTGEIAASELAEIGVSYAEIGHAERRRLFGETDADTAAKAT
AALAAGLTPLLCLGETERTASDVAAATVVAQLHADLEGAPAGAVTVAYEPVWAIGAESPA
SIPHIVRVTRALREALDALPERTGSAVVYGGSAGPGLLTDLDGAVDGLFLGRFAHDPAQL
RRVIDEAAARAAVSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccggtatgggtgggagtgagcctgaagacgtacttcgggcactcccgcgct
ctcgcgtggctgcgcgaggtcgccggggtcgtccgcgacactccggccgtcgcctccggc
gccgtgcggctcgtcgtcgtccccacctatctgcagatccccgcggcactcgaggccttc
gccgggacgggcgtgctgatcggcgcacaggatgtctcggcccacccgggcggggccttc
accggtgagatcgcggcgtcggagctcgcggagatcggcgtctcctatgcggagatcggc
catgccgagcgccgacgcctcttcggcgagaccgatgccgacacggcggcgaaagccacg
gcggccttggcggcgggtctcacccctctgctgtgtctgggggagaccgagagaaccgcg
tccgacgtcgctgccgcgaccgtcgtggcgcagctgcacgcggatctcgagggcgccccc
gccggtgcggtcaccgtcgcctacgagccggtgtgggcgatcggcgcggagtctccggca
tccattccgcacatcgtccgcgtcacgcgggcgctccgcgaggctctcgacgcgctgccc
gaacgcacgggcagcgcggtggtctacggcggctcggcggggcccggccttctcaccgac
ctggacggcgcggtcgacggcctgttcctggggcgcttcgcccacgatcccgcacagctt
cgacgagtcatcgacgaggccgccgctcgcgcggcggtgagcgcatga

DBGET integrated database retrieval system