KEGG   Microbacterium testaceum: MTES_2362Help
Entry
MTES_2362         CDS       T01423                                 

Definition
(GenBank) acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00010  Glycolysis / Gluconeogenesis
mts00620  Pyruvate metabolism
mts00640  Propanoate metabolism
mts00680  Methane metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01130  Biosynthesis of antibiotics
mts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_2362
   00620 Pyruvate metabolism
    MTES_2362
   00640 Propanoate metabolism
    MTES_2362
  Energy metabolism
   00680 Methane metabolism
    MTES_2362
Enzymes [BR:mts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MTES_2362
Lipid biosynthesis proteins [BR:mts01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MTES_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAJ75326
UniProt: E8NGM7
Position
2565278..2566972
Genome map
AA seq 564 aa AA seqDB search
MIPTVSATERYRAARDELLAARTDPDRAAAFTWPRFDGPFNWAIDWFDPMARGNDAPALI
VVDDDGTHHQRTFDELARRSDQVAAWLASRGVRRGDAVLLMLGNQVELWEAMLGIMKLGG
VIAPTTTALGARDLADRIERAEIRHVIVGAADADKFDDLPEGLGRIVVGGEHPGWAAYEE
AFLAEAGPARHPGTVADDRLLLYFTSGTTSKPKLVEHTHASYPVGHFTTMYWLGLQPGDV
HLAISSPGWAKHAWSLFFAPWIAGATVLALNYSRFSAERLLDELERDRVTTFCAPPTVWR
MLIQADLTGRRGALREVVSAGEPLNPEVIATVQRAWGLDIRDGYGQTEMTAVVANTPGAE
LVPGSMGRPLPGCPVVLIDPVTGEPADEGEICLDLSERPLNLMTGYVGDAERNDESTANG
LFHTGDVARRDALGTITYIGRTDDVFKSSDYKISPFELESVLIEHPAVVEAAVVPAPDDL
RLSVPKAYVVLASGFEPGEDVAIDILRYAREKLAPFQRLRRVEFLELPKTISGKIRRVEL
RQREEAVVRGEVTPVEWRDDALRG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgatccccaccgtctccgccaccgagcgctaccgcgccgcccgcgacgagctcctcgcg
gcgcgcaccgaccccgatcgggcggccgcgttcacctggccccggttcgacggaccgttc
aactgggcgatcgactggttcgaccccatggcgcgcggaaacgacgctcccgcgctgatc
gtcgtcgacgacgacggcacccaccaccagcgcacgttcgacgagctcgcgcgccgctcg
gatcaggtcgccgcatggttggcatcccgaggcgtccgccgcggcgacgcggtactgctc
atgctcggcaaccaggtcgagctgtgggaggcgatgctcggcatcatgaagctcggcggc
gtgatcgccccgaccacgaccgctctcggtgcgcgcgacctcgccgaccggatcgagagg
gccgagatccggcacgtcatcgtgggagctgcggatgccgacaagttcgacgatctgccc
gagggcctcggccgcatcgtcgtgggcggtgagcacccgggatgggccgcgtacgaggag
gcgttcctcgccgaggcggggcccgcgcggcatccggggaccgtcgcggacgaccgcctg
ctcctctacttcacgtcggggacgacgtcgaagccgaagctcgtcgagcacacgcacgcg
tcgtaccccgtcgggcacttcacgaccatgtactggctgggtctgcagcccggcgacgtg
cacctcgcgatcagctcgccggggtgggcgaagcacgcgtggagcctcttcttcgcgccg
tggatcgccggggcgacggtgctcgcgctgaactactcccggttctcggccgagcgcctg
ctcgacgagctcgagcgcgaccgggtgacgacgttctgcgccccgccgacggtgtggcgg
atgctgatccaggccgatctcaccgggcgtcgcggggccctgcgcgaggtcgtttcggcg
ggggagcccctcaaccccgaggtcatcgcgaccgtgcagcgcgcgtggggcctcgacatc
cgcgacggctacggccagaccgagatgaccgccgtcgtcgcgaacacgccgggcgccgag
ctcgttcccgggtcgatgggacgcccgctgcccggctgcccggtcgtgctgatcgacccg
gtgaccggggagccggccgacgagggcgagatctgcctcgacctgtcggagcggccgctc
aacctcatgaccgggtacgtcggtgacgcggagcgcaacgacgagtcgaccgcgaacggt
ctgttccacacgggcgatgtcgcgcgccgcgacgccctcggcaccatcacctacatcggc
cgcaccgatgacgtgttcaagtcctccgactacaagatcagcccgttcgagctcgagagc
gtgctcatcgagcatcccgccgtcgtcgaggcggcggtggtccccgcgcccgacgatctg
cgcctgtccgtgcccaaggcgtacgtcgtcctggcatccggattcgagcccggcgaggac
gtcgcgatcgacatcctccgctacgcgcgggagaagctcgctccgttccagcggctgcgc
cgcgtcgagttcctcgagctccccaagacgatctcgggcaagatccgtcgcgtcgagctg
cgccagcgcgaggaggccgtggtgcgcggcgaggtcactccggtggagtggcgcgacgac
gccttgcggggatga

DBGET integrated database retrieval system