KEGG   Microbacterium testaceum: MTES_2574Help
Entry
MTES_2574         CDS       T01423                                 

Definition
(GenBank) L-alanine-DL-glutamate epimerase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
mts  Microbacterium testaceum
Pathway
mts00051  Fructose and mannose metabolism
mts01100  Metabolic pathways
mts01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MTES_2574
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     MTES_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N DUF3025
Motif
Other DBs
NCBI-ProteinID: BAJ75538
UniProt: E8N7A6
Position
2782105..2783406
Genome map
AA seq 433 aa AA seqDB search
MTTITAVTAHDVRFPTSLSMDGSDAMNKDGDYSAAYVVVHTDDPELKGYGFTFTIGRGND
LCVEAARQRGLPLVGRSVEDAVADLGGVYRDLASDSQLRWLGPEKGVVHLGMAAVMNAMW
DLAARVAQKPLWRLLADMTPEQLVDVADMRYLSDALTRDEAIGILTELAPTRAARIAELE
GRGGYPCYTTSAGWLGYSDDKLRRLLQEAVDEGYRHVKLKVGASLDDDIRRLRIAREVIG
WDANLMIDANQVWDVPEAIEWMSHLAEFKPLWIEEPTSPDDVLGHAAVRKAVAPIGVATG
EHGMNRVLFKQMFQAEAIDFCQLDSARLASVNEIIAVYLMAAKFGVPVCPHAGGVGLCEL
VQHLSIFDFVCVSGTLENRVTEFVDHLHEHFVDPCIVENGAYVLPSLPGYSAEMHDASVA
EYTFPEGTYWASR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatcaccgccgtcaccgcgcacgacgtgcgctttccgacctcgctcagcatg
gacgggtcggatgccatgaacaaggacggcgactactccgccgcctacgtggtggtgcac
accgacgacccggagctgaagggctacggcttcacgttcaccatcggccgcggcaacgac
ctgtgcgtggaggcggcgcgtcagcgtggactgcccctcgtcggacgctcggtcgaagac
gcggtcgcagacctcgggggtgtctaccgcgatctcgcctccgactcccagctgcgctgg
ctcggccccgagaaaggcgtcgtccacctcgggatggcggcggtcatgaacgcgatgtgg
gatctcgccgcgcgggtcgctcagaagccgctctggcgcctgctcgccgacatgacgccg
gagcagctcgtcgatgtcgccgacatgcgctacctgtcggacgccctcacgcgcgacgag
gccatcggcatcctcaccgaactcgcccccacgcgcgccgcgcgcatcgccgagctcgag
ggccgaggcggctacccctgctacaccacgagtgccggctggctcggctacagcgacgac
aagctgcggcgtctgctgcaggaggccgtcgacgaggggtaccgccacgtcaagctcaag
gtcggggcgagcctcgacgatgacatccggcgcctgcgcatcgcgcgagaggtgatcggg
tgggatgccaacctgatgatcgatgcgaaccaggtctgggacgtccccgaggcgatcgag
tggatgagccacctcgccgagttcaagccgctgtggatcgaagagcccacgagccccgac
gacgtgctggggcacgccgcggtgcgcaaggccgtcgccccgatcggcgtcgcgaccggc
gagcacgggatgaaccgcgtgctgttcaagcagatgttccaggccgaggcgatcgacttc
tgtcagctcgactccgcccgcctcgcgagcgtgaacgagatcatcgcggtctacctgatg
gccgcgaagttcggggtgccggtctgcccgcacgccggcggggtcggtctgtgcgagctc
gtgcagcacctgtcgatcttcgacttcgtgtgcgtctccgggacgctcgagaaccgtgtg
accgagttcgtcgaccacctgcacgagcacttcgtcgacccgtgcatcgtcgagaacggc
gcgtacgtgcttccctcgttgcccggctacagcgccgagatgcacgacgcctcggtcgcc
gagtacaccttccccgagggaacgtactgggcgagccggtga

DBGET integrated database retrieval system