KEGG   Microbacterium testaceum: MTES_2646Help
Entry
MTES_2646         CDS       T01423                                 

Gene name
mqoA
Definition
(GenBank) predicted dehydrogenase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mts  Microbacterium testaceum
Pathway
mts00020  Citrate cycle (TCA cycle)
mts00620  Pyruvate metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01200  Carbon metabolism
Module
mts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTES_2646 (mqoA)
   00620 Pyruvate metabolism
    MTES_2646 (mqoA)
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MTES_2646 (mqoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAJ75610
UniProt: E8N7Z0
Position
2868553..2870025
Genome map
AA seq 490 aa AA seqDB search
MTENVDVLLIGGGIMSATLGTLLKDLQPDLKIAVMERLSDVAQESSNAWNNAGTGHAALC
ELNYTPEAKDGSIDPAKAVTINEQFQQSRQLWASLVAEGVLDEPSTFINATPHMTFVRGE
KDVAFLRKRYEVLREQPLFAGIEYSEDSRVINQWAPLLMQKRRKGEPFAATRVPAGTDVD
FGSLTRQLFANLREKGVEVVTNHDVKKLKKQKDGSWEVSYRHVIGGTPGSINAKFVFVGA
GGWALKLLQRSGIPEIKGYGVFPIGGQWLKTSNPDIVAKHHAKVYSQASVGAPPMSVPHL
DTRVIDGESSLLFGPFATFSPKFLKNGSMLDIVTQVRPHNLLPMLKVAVDNPGLIKYLIS
ELLKTHAKKVDSLRDFMPTAQAEDWELLDAGQRAQVMKKDKDKGGVLQFGTEVITASDRS
IAGLLGASPGASTAVSIMLGLIKTCFPERMPEWEPRLRELIPSYGESLNTRPEAARKELD
ATAQALKINP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaaaacgtcgatgttctcctcatcggtggcggcatcatgtccgccactctcggc
acgctgctgaaggacctccagcccgatctgaagatcgcggtcatggagcgcttgagcgac
gtcgcgcaggagagctcgaacgcctggaacaacgccggcaccggtcacgcggccctctgc
gagctgaactacacgcccgaggcgaaggacgggtcgatcgacccggccaaggccgtcacg
atcaacgagcagttccagcagagccgtcagctctgggcctcgctcgtagccgagggtgtg
ctggacgagccctcgacgttcatcaacgcgaccccgcacatgacgttcgtgcgcggcgag
aaggacgtcgccttcctccgtaagcgctacgaggtgctccgggagcagccgctgttcgcg
ggcatcgagtacagcgaggactcccgcgtcatcaaccagtgggcgccgctgctgatgcag
aagcgccgcaagggcgagcccttcgcggccacgcgggttcccgccggcaccgacgtcgac
ttcggctcgctcacgcgccagctcttcgccaacctgcgcgagaagggcgtcgaggtcgtc
acgaaccacgacgtcaagaagctgaagaagcagaaggacggctcctgggaggtctcgtac
cgccacgtgatcggcggcacccccgggtcgatcaacgcgaagttcgtcttcgtcggtgcg
ggtgggtgggcgctcaagctcctgcagcgctccggcatccccgagatcaagggctacggc
gtcttcccgatcggcggtcagtggctcaagacctccaaccccgacatcgtcgcgaagcac
cacgccaaggtctactcgcaggcgtcggtcggggctccgcccatgtcggtcccgcacctc
gacacccgcgtcatcgacggcgagtcctcgctgctgttcggaccgttcgcgaccttcagc
cccaagttcctcaagaacgggtcgatgctcgacatcgtcacccaggtgcgaccgcacaac
ctcctgccgatgctgaaggtcgcggtcgacaaccccggcctcatcaagtacctgatcagc
gagctcttgaagacccacgcgaagaaggtcgacagcctccgcgacttcatgccgacggcc
caggccgaggactgggagctgctcgacgccggtcagcgcgcccaggtgatgaagaaagac
aaagacaagggcggggtgctgcagttcggcaccgaggtcatcacggcctccgaccgctcg
atcgcgggtctcctcggcgcctccccgggggcgtccaccgcggtgtcgatcatgctcggc
ctgatcaagacgtgcttccccgagcgcatgcccgagtgggaaccgcgcctgcgcgagctc
atccccagctatggcgagtcgctcaacacgcggcccgaggcggcgcgcaaagaactggat
gccacggcccaggcgctgaagatcaacccctga

DBGET integrated database retrieval system