KEGG   Microbacterium testaceum: MTES_2735Help
Entry
MTES_2735         CDS       T01423                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
mts  Microbacterium testaceum
Pathway
mts00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mts00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MTES_2735 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mts01007]
    MTES_2735 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mts03016]
    MTES_2735 (cysS)
Enzymes [BR:mts01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     MTES_2735 (cysS)
Amino acid related enzymes [BR:mts01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MTES_2735 (cysS)
Transfer RNA biogenesis [BR:mts03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MTES_2735 (cysS)
 Prokaryotic Type
    MTES_2735 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAJ75699
UniProt: E8N8P3
Position
2968112..2969506
Genome map
AA seq 464 aa AA seqDB search
MTVRLYDTRAQALRDFAPLDPSNVTVYVCGPTVQSGPHIGHVRAALAFDLLRRWLAHRYG
RVTFVRNVTDIDDKVLANATATEPWWALAYRMELEFSRAYAAIGILPPTYEPRATASVTQ
MQELIAELIERGHAYAAAGDVYFDVRSWPAYGELTRQSLDAMEPAADADPRGKRDPRDFA
LWKGAKDDEPASATWASPWGAGRPGWHIECSAMSRRYLGPEFDIHGGGLDLRFPHHENEI
AQSTAAGDAFARYWVHNGLVTVDGQKMSKSLGNFTLASDVLAENDPRVVRYALAAAHYRS
NLDVSDRAFAEAASALGRIATFRQRVLRAAGADPTVILPGDVPETFAAAMDDDLSVPQAL
AVVHETVRAGNVALDAGDLDAGVAAHRSVAAMLGILGLDADEPAVATGSSETALDALVQT
MITQRAQARADKDWAAADRIRDAIAAAGITLEDTPAGTHWSIDG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgactgttcggctgtacgacacgagagcgcaggccctgcgcgacttcgctcctctcgac
ccctcgaacgtcacggtctacgtctgcggccccaccgtgcagtcgggcccgcacatcggt
catgtgcgcgcggccctcgcgttcgatctgctccgccgctggctcgcccaccggtacggc
cgggtgaccttcgtccgcaacgtcaccgacatcgacgacaaggtgctcgcgaacgccacc
gccaccgaaccgtggtgggcgctcgcctaccgcatggagctcgaattctcgcgcgcctac
gcggccatcggcatcctgccccccacatacgaaccgcgggcgaccgcctccgtgacgcag
atgcaggagttgatcgccgagctcatcgagcggggtcacgcgtacgccgccgccggcgac
gtctacttcgacgtgcggtcctggcccgcgtacggcgagctgacccggcagagcctggat
gccatggagcccgccgccgatgccgaccctcggggcaagcgggacccgcgcgacttcgcc
ctctggaagggggcgaaggacgacgagcccgcttcggccacctgggcgtcgccctgggga
gcgggccggccgggctggcatatcgagtgctcggcgatgtcgcgccgctacctcggtccg
gagttcgacatccacgggggcggtctcgacctgcgcttcccccaccacgagaacgagatc
gcccagtccaccgcggcgggcgacgcgttcgcgcggtactgggtgcacaacgggctcgtg
accgtcgatgggcagaagatgtcgaagtcgctgggcaacttcacgctcgcgtccgacgtg
ctggccgagaacgatccccgcgtggtgcgttatgcgctggccgcggcgcattaccggtcg
aacctcgacgtttccgatcgcgccttcgccgaggcggccagcgccctgggccgcatcgcg
acgttccgccagcgcgtgctgcgcgccgccggggccgaccccaccgtgatccttcccggg
gacgtccccgagacgttcgccgccgccatggacgacgacctcagcgttcctcaggccctc
gccgtggtgcacgagacggtgcgcgccggtaacgtcgccctcgatgcgggcgacctcgac
gccggcgtcgcggcccatcgctccgtcgccgcgatgctcggcatcctgggactggatgcc
gacgagcccgcggtcgcgacaggatcgagcgagaccgctctcgacgccctcgtgcagacg
atgatcactcagcgcgctcaggcgcgcgccgacaaggactgggcggcggccgatcgcatc
cgtgatgccatcgccgccgcaggaatcacgctggaggacactccggccggaacacattgg
agtatcgatggctaa

DBGET integrated database retrieval system