KEGG   Microbacterium testaceum: MTES_3187Help
Entry
MTES_3187         CDS       T01423                                 

Definition
(GenBank) acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
mts  Microbacterium testaceum
Pathway
mts00072  Synthesis and degradation of ketone bodies
mts00280  Valine, leucine and isoleucine degradation
mts00650  Butanoate metabolism
mts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MTES_3187
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MTES_3187
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTES_3187
Enzymes [BR:mts01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     MTES_3187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: BAJ76151
UniProt: E8NCS1
Position
3455290..3456174
Genome map
AA seq 294 aa AA seqDB search
MIDKTWTSAADAVSDIPDGASIAVGGFGLSGNPIALIEALLAQGTRDLSVVSNNCGVDDW
GLGILLGAGRIRKMTSSYVGENKEFERQFLSGELELELTPQGTLAEKLRAGGSGIAAFYT
QTGVGTQVAEGGLPQRYDGAGGIAVASPAKDVRIFEVGGEPREFVLEQAITTDFALVHAW
KGDRHGNLVFRKAARNFNPLAAMAGRTCIAQVEHLVEPGEIEPDDVHLPGVFVHRVVEVG
PAIEKRIEKRTVREGAVEPSPVPSTGSGTSAVTEASSSVPSTGSGTSTATTKEI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacaagacctggacctcggccgccgacgcggtctccgacatccccgacggcgcg
tcgatcgccgtcggcggcttcggcctctccggcaaccccatcgccctcatcgaagcgctc
ctcgcgcagggcacgcgcgacctctcggtcgtctcgaacaactgtggcgtcgacgactgg
gggctcggcatcctgctcggtgccggacgcatccgcaagatgacctcgtcctacgtgggg
gagaacaaggagttcgagcggcagttcctctccggagaactcgagctcgagctgaccccg
cagggcaccctcgcggagaagctccgcgcgggagggtcgggtatcgctgccttctacacg
cagacgggcgtcgggacgcaggtcgccgagggcggcctcccgcagcggtacgacggcgcc
ggcggtatcgcggtcgcgtcgcccgccaaggacgtgcgcatcttcgaggtcggcggggag
ccgcgggagttcgtgctcgaacaggccatcaccaccgacttcgcgctcgtccacgcctgg
aagggcgaccgccacggcaacctcgtgttccgcaaggcagcccgtaatttcaacccgctc
gccgcgatggccgggcgcacgtgcatcgcgcaggtcgagcacctcgtcgagcccggcgag
atcgagcccgacgacgtccaccttcccggggtgttcgtccatcgtgtcgtcgaggtcggt
cccgcgatcgagaagcgcatcgagaagcgcacggtccgtgagggtgccgtcgagccgagc
ccggtcccttcgacaggctcagggacctctgccgtgaccgaggcgtcgagttcggtccct
tcgacaggctcaggaacctcgaccgcgacgactaaggagatctga

DBGET integrated database retrieval system