KEGG   Microbacterium testaceum: MTES_3356Help
Entry
MTES_3356         CDS       T01423                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mts  Microbacterium testaceum
Pathway
mts00330  Arginine and proline metabolism
mts00332  Carbapenem biosynthesis
mts01100  Metabolic pathways
mts01130  Biosynthesis of antibiotics
mts01230  Biosynthesis of amino acids
Module
mts_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MTES_3356 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MTES_3356 (proB)
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MTES_3356 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DUF99
Motif
Other DBs
NCBI-ProteinID: BAJ76320
UniProt: E8NE66
Position
3632641..3633477
Genome map
AA seq 278 aa AA seqDB search
MTAATRADIPRASRVVVKVGSSSISGDGAHRIDTIVEALSRANAAGVEVVLVSSGAIATA
LPLLDLQGRPNDLATQQAAAAVGQNVLMWRYQTSLDRFGLLAGQVLLTAGDLENATSRSN
ARRAMERLLGLGILPIVNENDTVATHEIRFGDNDRLAALVAQLIGADALVLLSDIACLYT
APPNEPGARPITEVAWGDDLSDFEFGAGVVNGVGTGGAATKASAAKLASAAGVGVLVTSA
DLVADALAGESVGTWFVPNPDAVTLSTGPVGAVSATVD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgacggccgcgacccgcgccgacatcccccgcgcgtcccgcgtcgtcgtcaaggtcggc
tcctcgtcgatcagcggggacggggcgcaccgcatcgacacgatcgtcgaggctctctcg
cgcgcgaacgccgcaggtgtcgaggtcgtcctggtgtcctccggcgcgatcgcgacggct
cttccgttgctcgacctgcagggccgaccgaacgacctcgcgacccagcaggcggccgcc
gccgtcggccagaacgtcctcatgtggcgctaccagacctctctcgaccgcttcggcctg
ctcgccgggcaggtgctgctcacggccggcgatctcgagaacgccacgtcgcgctccaac
gcgcgccgggcgatggaacggctgctggggctcggcatcctgcccatcgtcaacgagaac
gacacggtggccacgcacgagatccgcttcggcgacaacgaccggctcgcggccctcgtc
gctcagctgatcggcgccgacgcgctcgtcctgctcagcgacatcgcgtgcctgtacacc
gcgcccccgaacgagccgggagcccgccccatcacggaagtcgcgtggggggatgacctg
tccgacttcgagttcggggcgggcgtcgtcaacggcgtcggcaccgggggcgcggcgacc
aaggcctcggctgcgaagctcgcgtccgcggccggtgtcggcgtcctggtgaccagtgcc
gacctcgtcgccgacgctctcgcgggggagtccgtgggcacgtggttcgtcccaaatccg
gatgccgtcaccctgtcgaccggccccgtcggcgccgtcagcgcgacggtagactga

DBGET integrated database retrieval system