KEGG   Marivirga tractuosa: Ftrac_1686Help
Entry
Ftrac_1686        CDS       T01365                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00071  Fatty acid degradation
mtt00362  Benzoate degradation
mtt00650  Butanoate metabolism
mtt01100  Metabolic pathways
mtt01120  Microbial metabolism in diverse environments
mtt01200  Carbon metabolism
mtt01212  Fatty acid metabolism
Module
mtt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Ftrac_1686
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ftrac_1686
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ftrac_1686
Enzymes [BR:mtt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Ftrac_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA Pyr_redox_2 NAD_binding_2 Peptidase_S49 UDPG_MGDP_dh_N Pyr_redox NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ADR21674
UniProt: E4TQX4
Position
complement(2025439..2027841)
Genome map
AA seq 800 aa AA seqDB search
MKRNIKKVAVLGSGIMGSRIACHFANIGVEVLLLDIVPFELTDAEKEKGLTKEDPQVRNR
IVNDAFESTLKGKPASLYHKDFAKRISLGNFDDDMHKIKDCDWVLEAVVERLDIKKQVFE
NVEKHRTKGTIISSNTSGIPIHMMLEDRSEDFQKHFIGTHFFNPPRYLKLLEIIPTPKTD
QEITDFLMHYGDLYLGKTTVLCKDTPAFIANRVGIYAILKVVESMQKLDMNIDEVDKLTG
PVIGRPKSATFRTSDVVGLDTLIKVANGLYENLPNDEARDTFKLPDVIGKLEENKWLGDK
TGQGFYKKTKKDGKTEILTLDLDSMEYKPKTKPKFSTLESTKQISNLKERFPVLVGGKDK
AGEFYRDSFYGLFQYSSNRIPEISDELYRIDQALCTGFGWEIGPFETWDALGVKKSVEKM
EEAGYKPNQWVYDMLESGADSFYRVEAGQKQYYDIESKKYVNIPGTEEFIILENLKESGK
EIWSNAEAGIIDLGDGIINVEFRSKSNSLGGGVVEGINKAISMAEEKYRGVVISNEGSNF
SVGANLGMIFMYAIEQDYDELDFMIRQFQQTMMRARYSAIPVVVAPHNMALGGGCELSMH
ADHVQASAETYIGLVEVGVGVIPGGGGTKENALRVADRYQDGDVELNALQNAYMNIAMAK
VATSAHEARDMGILRPSDGISINRSRQIADAKAAAISLADAGYTMPVQRTDIKVQGKTGI
ALFKAGVSGMKMGRYISEHDQKIADKLAYVMCGGDLSYPQEVSEQYLLDLEREAFLSLLG
EKKTLERIQAVLQGGKPLRN
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacattaaaaaagtagccgttttaggttcggggattatgggatcaagaatc
gcctgccactttgccaatattggtgtggaggtacttttgcttgacatcgtgcctttcgaa
cttacggatgccgaaaaagaaaaaggtttaacgaaggaagacccacaagtgagaaaccgc
atcgtgaatgacgcatttgagtcaaccttaaaaggaaagccagcttcattatatcataaa
gattttgccaagagaatttctttgggaaattttgatgatgatatgcacaaaatcaaagat
tgcgattgggtattggaagccgttgttgagcgactggatatcaaaaagcaggtttttgaa
aatgttgaaaaacatagaactaaaggaaccattatttcttctaacacatcgggtatccct
atccacatgatgttggaagacagaagtgaagactttcaaaagcattttattggaacgcac
ttttttaacccaccgcgttacttaaaattattggagattatccctacaccaaaaacagat
caggaaatcactgatttcttgatgcattatggtgatttatatttagggaaaaccaccgtt
ttatgtaaagatactcctgccttcatcgctaacagagttggaatttatgccatcttgaaa
gtagtggaatccatgcaaaaactggacatgaacatcgatgaggtagacaaattaacgggc
ccagttatcggccgaccaaagtcagcaaccttcaggacttcagatgtggtaggattagat
acgcttattaaagtagccaacggattatacgaaaatcttccaaatgatgaggctagagat
acttttaaattgcctgatgtaattgggaaattagaagaaaacaaatggttaggggataag
accggacaaggattctataaaaaaaccaagaaagacggaaaaactgaaatcttaactttg
gatttggattctatggaatacaagccaaagacaaagcctaagttttcaacacttgagtct
accaagcaaatctctaatttgaaagaaagattcccagttttagtgggaggaaaagataaa
gcaggtgaattctatagagattcattctatgggttatttcaatactcatctaatcgtatc
cctgaaatttctgacgagttatatagaattgaccaagcactttgcactggtttcggttgg
gaaataggtcctttcgaaacttgggatgctttaggtgttaagaaatcagttgaaaaaatg
gaagaagcaggttataagccaaatcaatgggtttatgacatgttagaatccggtgctgat
tcgttctacagagtagaagcaggacagaaacagtattatgatattgaaagcaagaaatat
gtaaatatcccaggtactgaagaatttatcattcttgaaaacttaaaagaaagtggtaag
gaaatctggagtaatgcagaagccggaatcattgatttaggagatggcattattaatgtg
gaattcagatcgaagtcaaactcacttggtggcggagttgtagaaggcattaacaaggct
atttcgatggctgaggaaaaataccgaggtgtagtaatctccaatgagggctcaaacttc
tcagtaggagctaaccttggaatgattttcatgtatgcaatcgagcaagattatgatgaa
ttggattttatgatccgtcagttccagcaaaccatgatgagagctagatattctgcaatt
ccagttgtagtggcgcctcacaatatggcactaggtggaggttgtgaattgtctatgcat
gcagatcatgttcaggcatcagctgaaacctatattggtttagttgaagttggtgttggt
gtaattcctggtgggggtggtactaaagaaaatgcccttcgagttgcagatagatatcaa
gatggtgatgttgagttaaatgctttacaaaatgcatacatgaatattgcaatggcaaaa
gtggctacttcagctcatgaggctagagatatgggtatattaagaccttcagatggtatt
tctataaacagaagtcgtcagattgctgatgcgaaagctgctgcaattagtttagcagat
gctggatatactatgccagttcaaagaacagatatcaaagttcagggtaaaacaggcatc
gctttatttaaggcaggtgtttctggtatgaagatggggagatatatctcagaacatgat
caaaagatcgcagataagctagcttatgtgatgtgcggtggagatttatcatatcctcag
gaagtttcagaacaatacctattggatctagaaagagaagctttcttatctctattagga
gaaaagaaaacacttgaaagaattcaagcagtattgcaaggaggaaaacctttgagaaac
tag

DBGET integrated database retrieval system