KEGG   Marivirga tractuosa: Ftrac_3576Help
Entry
Ftrac_3576        CDS       T01365                                 

Definition
(GenBank) Glycogen(starch) synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00500  Starch and sucrose metabolism
mtt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ftrac_3576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtt01003]
    Ftrac_3576
Enzymes [BR:mtt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Ftrac_3576
Glycosyltransferases [BR:mtt01003]
 Polysaccharide
  Storage polysaccharide
   Ftrac_3576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ADR23546
UniProt: E4TP12
Position
4229881..4231704
Genome map
AA seq 607 aa AA seqDB search
MNENNTIENEKHILTEIAWEVCNQVGGIYTVIRSKVPTMVKNWGKNYFLIGPYAPKEAAT
DFEEAEFGHDVIDETLRICREKGLHIKSGYWLVSGRPQTLLFDHKSSFHQLGDIKYYYWQ
NHGIDFKNHDPLMDEVLAFGYMVHIFLSEMTRVAIDKKIKPLAHFHEWMAGSAIPNLRRD
QVPLQTVFTTHATLLGRYLAMNDPQFYDHLPFMDWHKEAVHFNVEANVKLERACVHGAHV
FTTVSEVTGKECFHLLGRSPDKILPNGLNIERFSVLHEVQNLHHKYKQVLEQFIMGHFFK
SYSFDLNKTLYFFTSGRFEYSNKGYDLTLEALARLNHRLKEARSPLTVVMFFITRQPIQS
INPEVLNARAMLDKINTNSNAIVEQIKNRLYRQAASSKGDHKLPNLNDMVDDYWKLRHRR
TIQAWKSGGLPPVVTHNLVDDANDNILNFLRTANLINHESDKVKVVYHPDFISSTNPLFG
MEYDDFVRACHLGVFPSYYEPWGYTPLESLARGVASVTSDLSGFGDYMKNVSIGDKKHGM
FIVKRANKSFHEAAEELTNVMWEFTQITSRERIDMRNQSEDLSEVFDWKNLYKAYENSYK
MALETYF
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaataatacgattgaaaatgagaaacatatcctaactgaaattgcttgggaa
gtatgtaatcaagtaggaggaatttacaccgtaatccgttctaaggttccaacaatggtc
aaaaactggggtaagaattattttttgattggaccttacgcaccaaaagaagcagccact
gattttgaggaagctgaatttggacacgatgtaatagatgaaactttaagaatatgccgc
gaaaaaggattgcatattaaatctggctattggttggtttcgggaagacctcagacacta
ctatttgatcataaatcgtcttttcatcaattaggagatattaaatattactactggcaa
aatcatggtattgattttaagaatcatgatcccttgatggatgaggtattggcttttggg
tatatggtgcatatttttctttcagaaatgactagagtagctattgataagaaaattaag
cctctggctcattttcatgaatggatggcgggttcggctattccgaatttaagaagagac
caagtgcctttgcaaacagtgttcactactcatgctacgcttttgggaagatacttggca
atgaacgacccgcaattctatgaccaccttccttttatggattggcacaaagaagcagtc
catttcaatgtcgaagcaaacgttaaattagaacgtgcctgtgtacatggtgctcatgtt
tttaccacggtaagtgaagtaacaggcaaggagtgttttcatctcttaggaagaagccct
gataagattctccctaacggtttgaacattgagcgattttcggtgttacacgaggtacag
aacttgcatcataagtataagcaagtattggaacagtttatcatggggcattttttcaag
agctattctttcgatttgaacaaaaccctttatttttttacttcgggtaggttcgaatac
tccaataaaggctatgatttaaccttagaggctttggcccgcttaaatcatcgtctaaag
gaagcacggtccccactaactgttgtcatgtttttcataactagacaacctatacaatcg
atcaatcctgaggttttgaatgccagagccatgttggataaaatcaatacgaattccaat
gcaattgtagaacaaattaaaaacagactgtatagacaagctgcctctagcaaaggggat
cataagctaccaaatctgaatgacatggtagatgattactggaagcttagacacagaaga
accattcaagcttggaagtcaggtggattacctcctgtagtcacgcataacttagtggat
gatgctaatgataatattttaaattttttaagaactgccaaccttattaatcatgaatcc
gataaagttaaagtagtgtatcatcctgatttcatctcttccaccaatccattatttgga
atggaatatgatgattttgtgagggcttgccatttaggggtcttcccaagctattatgag
ccgtggggatatactcctttagaatcactggcgaggggagttgcttcggtgacttcagat
ttatcaggatttggtgattatatgaaaaacgtaagcatcggtgataaaaagcatggcatg
tttatagtaaaaagagccaataaaagcttccatgaagctgctgaagaattgaccaacgtg
atgtgggaatttactcaaatcactagcagagaacgaatagatatgagaaatcaatcagaa
gatttgtcagaagtttttgattggaagaatttatataaagcctacgaaaacagttataag
atggctttagaaacttatttttaa

DBGET integrated database retrieval system