KEGG   Marivirga tractuosa: Ftrac_3652Help
Entry
Ftrac_3652        CDS       T01365                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00620  Pyruvate metabolism
mtt00630  Glyoxylate and dicarboxylate metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01120  Microbial metabolism in diverse environments
mtt01200  Carbon metabolism
Module
mtt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ftrac_3652
   00630 Glyoxylate and dicarboxylate metabolism
    Ftrac_3652
Enzymes [BR:mtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ftrac_3652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADR23621
UniProt: E4TPT4
Position
complement(4335225..4336817)
Genome map
AA seq 530 aa AA seqDB search
METTSAQLRNTKKENERFTLLTDEAISFLNKLHERFNERRLELLGRREQVTDQIRHGKDL
DFPKTTEDIRNNPDWRIAPLPKDLQNRKVEITGPVDRKMIINALNSGAKVFMADFEDATS
PSWKNITDGQQNVYDAIRKQIDFTAENGKTYKLKDKTAVLKVRPRGWHLSEKNFLVNGEQ
ISASLFDFGLYFFHNAHELIRNGSGPYFYLPKLEHRCEARLWNEVFIFAQNELGIPVGTI
KATVLVETITAAFQMEEIIYELRDHMAGLNAGRWDYIFSFIKKFRDRPDYILPDRNQVTM
QVPFMKAYANLLVKTCHKRGAHAIGGMSAFIPTKDKEQNEKIFDKVRNDKTEEALAGYDG
SWVAHPALIPAVEAVFDQIIGDKPHQKHVLRDEFNTTPSALTSPNVMYGEVTEKGVRMNI
NVALLYIESWLQGTGAAALYNLMEDAATAEISRAQLWQWFHHQVSFKNGKIFNRALFCVL
LEEETEKVKEMLGQERVETGKLAIARDLLKNLVKSEDFEDFLTLKAYPHL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaaactacatcagcacaattaagaaatactaaaaaggaaaatgagcgctttacctta
ttgacagatgaagctatttcatttttaaataaactgcacgaaaggttcaatgagagaaga
ttggagctcttaggtagaagagagcaagtcactgatcaaattagacatggaaaagatctg
gatttccctaaaactacagaagacattagaaataatcctgattggagaattgctcccttg
ccaaaagacctacagaataggaaagtagaaattactggtcctgtagatcggaaaatgatc
atcaatgcactaaactcaggtgcaaaggtttttatggctgactttgaagatgctacaagt
ccttcttggaaaaacatcacagatggacagcaaaacgtatatgatgcaatcagaaaacaa
attgactttaccgcagaaaatggtaaaacctacaagttaaaagataaaaccgctgttcta
aaagtgagacccagaggctggcatttatcagagaaaaacttcttggttaatggggaacaa
atttctgcttcactcttcgacttcggcttatacttttttcacaatgcacacgaattgatt
agaaatggaagtggtccatacttttacttaccaaaattagaacaccgatgtgaggccaga
ctatggaatgaagtgttcatatttgcccaaaatgaactagggattccagttggcactata
aaagcaacggttttagtagaaacaatcacagctgctttccaaatggaagaaattatttat
gaattgagagaccatatggctggtttgaatgcaggcagatgggattacatctttagcttt
atcaagaaatttagagatagacccgattacattctaccagacagaaaccaagtaaccatg
caagtgccattcatgaaagcatatgcgaatctgttggttaaaacttgccataaacgaggt
gctcatgccattggcggtatgtctgctttcattccgactaaagataaagagcagaacgag
aaaatattcgacaaagtaagaaatgacaaaacggaggaagctttggcaggatatgacggc
agctgggtagctcaccctgccttaatccctgcagttgaagctgtttttgatcaaatcatt
ggagataaacctcatcaaaaacatgtactaagagatgaattcaacaccactccatctgct
ttaacaagtcctaatgtgatgtatggagaagtaactgaaaaaggagttcgcatgaacatc
aatgtggcacttttatacatcgaatcttggctgcaaggaactggagcagcagctctctac
aatttaatggaagatgctgcaacagctgaaatcagtagagctcaattatggcaatggttt
catcaccaagtatccttcaaaaatgggaagatatttaatagagcacttttctgtgtgctt
ttggaagaggagactgaaaaagtaaaagaaatgctaggtcaggaaagagtagaaacaggc
aagttggcaattgccagagatcttttgaaaaacctggtgaagagcgaggattttgaagac
ttcctgacattaaaagcatacccacatttataa

DBGET integrated database retrieval system