KEGG   Mycobacterium tuberculosis H37Rv: Rv0777Help
Entry
Rv0777            CDS       T00015                                 

Gene name
purB
Definition
(RefSeq) adenylosuccinate lyase PurB
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00250  Alanine, aspartate and glutamate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
mtu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0777 (purB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv0777 (purB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     Rv0777 (purB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ADSL_C
Motif
Other DBs
NCBI-GeneID: 888929
NCBI-ProteinID: NP_215291
TubercuList: Rv0777
UniProt: A0A089QJT5 I6XWA1
Position
870008..871426
Genome map
AA seq 472 aa AA seqDB search
MSIPNVLATRYASAEMVAIWSPEAKVVSERRLWLAVLRAQAELGVAVADSVLADYERVVD
DVDLASISARERVLRHDVKARIEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLEVIF
AHGVAAVARLAERAVSYRDLIMAGRSHNVAAQATTLGKRFASAAQEMMIALRRLRELIDR
YPLRGIKGPMGTGQDMLDLLGGDRAALADLERRVADFLGFATVFNSVGQVYPRSLDHDVV
SALVQLGAGPSSLAHTIRLMAGHELATEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMVAELAGAQWNEGDVFCSVVRRVALPDSFFAVDGQIETFLTVLDEFGAYPAVIGRE
LDRYLPFLATTKVLMAAVRAGMGRESAHRLISEHAVATALAMREHGAEPDLLDRLAADPR
LTLGRDALEAALADKKAFAGAAGDQVDDVVAMVDALVSRYPDAAKYTPGAIL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgagcattcccaacgtgctggccacccgatacgccagcgccgagatggtcgcgatctgg
tcgccggaggccaaggtggtctcggagcggcggttatggctggccgtattgcgggcacag
gcagagctgggggtagcggttgccgattcggtgctcgccgactacgaacgtgtggtcgac
gatgtggacttggcctcgatctcagcccgggagcgggtgctgcgccacgatgtcaaggcc
cgcatcgaggaattcaacgcattggccggtcatgagcacgtgcacaaggggatgaccagc
cgcgacctgaccgagaacgtggagcaactgcagattcggcggtcgctggaagtgattttc
gcccatggggtggcggcggtggcgcggctggccgagcgggcggtgagctaccgtgacctg
atcatggccgggcgcagccacaacgtggccgctcaggccaccaccttgggcaagcggttc
gcctcggcggcccaagagatgatgatcgcgttgaggcggttgagggagttgatcgaccgc
taccccctgcgtggcatcaagggcccgatgggcaccggtcaggacatgctcgatctgctg
ggcggtgaccgtgcggcgctggccgatctcgagcggcgcgtcgccgacttcttgggcttt
gcaactgttttcaacagcgtggggcaggtgtatccgcgttcattggaccacgacgtggtt
tcggctctggtgcagctcggcgcggggccgtcatcactggcacacacgattcgattgatg
gccggccacgagctcgccaccgagggtttcgcgccgggtcaggtcggttcgtcggcgatg
ccgcacaagatgaacacccgcagctgcgaacgggtcaacgggctgcaggttgtgctacgc
ggctatgcatccatggtggccgagttagccggtgcacagtggaacgagggtgatgtgttt
tgctccgtggtgcgccgggttgcgttgccggacagcttctttgccgtcgacgggcagatc
gagacgtttttgacggtgctggacgagttcggcgcctacccggcggtgatcggccgcgag
ttggatcgttatctgccgttcctggccaccactaaggtgctaatggcggccgtgcgcgcg
gggatgggtcgcgagtccgcgcaccggttgatctccgagcacgcggtggcgacggcgctg
gccatgcgagaacacggcgcggagcccgacctgctggaccggttggccgccgatccgcgg
ctgacgctgggacgagacgctttggaggccgcgctggccgacaagaaggcatttgccggt
gccgcgggtgaccaggtcgatgatgtggtcgcgatggtggacgcgctggtgagccgttac
ccggacgcggctaaatacacgccgggtgcaattctttag

DBGET integrated database retrieval system