KEGG   Mycobacterium tuberculosis H37Rv: Rv0046cHelp
Entry
Rv0046c           CDS       T00015                                 

Gene name
ino1
Definition
(RefSeq) inositol-3-phosphate synthase
  KO
K01858  myo-inositol-1-phosphate synthase [EC:5.5.1.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00521  Streptomycin biosynthesis
mtu00562  Inositol phosphate metabolism
mtu01100  Metabolic pathways
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Rv0046c (ino1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv0046c (ino1)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.4  inositol-3-phosphate synthase
     Rv0046c (ino1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inos-1-P_synth NAD_binding_5
Motif
Other DBs
NCBI-GeneID: 887028
NCBI-ProteinID: NP_214560
TubercuList: Rv0046c
UniProt: P9WKI1 I6X8D3
Structure
PDB: 

Position
complement(50021..51124)
Genome map
AA seq 367 aa AA seqDB search
MSEHQSLPAPEASTEVRVAIVGVGNCASSLVQGVEYYYNADDTSTVPGLMHVRFGPYHVR
DVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTNVIVQRGPTLDGIGKYYADTI
ELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAIDAGVAFVNALPVFIASDP
VWAKKFTDARVPIVGDDIKSQVGATITHRVLAKLFEDRGVQLDRTMQLNVGGNMDFLNML
ERERLESKKISKTQAVTSNLKREFKTKDVHIGPSDHVGWLDDRKWAYVRLEGRAFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASAYLMKSPPEQLPDDIARAQ
LEEFIIG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaccagtcgttaccggcgccggaggcgtcgacggaggttcgagtcgccatt
gtcggcgtcggcaactgcgcgtcctcgctggtccagggcgtcgagtactactacaacgcc
gacgacacatcgaccgtaccgggcctcatgcacgtgcggttcggcccgtaccacgttcgc
gacgtcaagttcgtggcggcgttcgacgtggacgccaagaaggtcggcttcgacctgtcc
gacgccatcttcgcctcggagaacaacaccatcaagatcgccgatgtggcgccgaccaac
gtgatcgtgcagcgcgggcctaccctcgatggcatcggcaagtactacgccgacaccatc
gaactctccgacgcggagcccgtcgacgtcgtccaggcgctcaaggaggccaaggtcgac
gtgctggtctcctatttgccggtgggctcggaggaagccgacaagttctacgcccagtgt
gctatcgacgccggggtggcgttcgtcaacgcgctgccggtgttcatcgcctccgacccg
gtgtgggccaagaagttcaccgacgccagggtacccatcgtcggtgatgacatcaagagc
caggtcggcgcgacgatcacccaccgggtgctggccaagctgttcgaggaccgcggcgtg
cagctcgaccgcaccatgcagctcaacgtgggcggcaacatggacttcctcaacatgctc
gaacgtgaacggctggagtccaagaagatctccaagacccaggccgtcacttcgaatctg
aagcgcgagttcaagaccaaggacgtgcacatcggcccgtccgaccacgtcggatggctc
gacgatcgcaaatgggcctatgtccgtcttgagggccgcgccttcggagatgtgccgttg
aacctggagtacaagctcgaggtgtgggactcgccaaactcggccggcgtcatcatcgac
gcggtgcgggcggccaagatcgccaaggaccgcggcatcggcggaccggtgatcccggcg
tcggcctacctgatgaagagcccgcccgagcagctgcccgacgacatcgcgcgcgcgcaa
ctcgaagagttcatcatcggttag

DBGET integrated database retrieval system