KEGG   Mycobacterium tuberculosis H37Rv: Rv0069cHelp
Entry
Rv0069c           CDS       T00015                                 

Gene name
sdaA
Definition
(RefSeq) L-serine dehydratase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00270  Cysteine and methionine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv0069c (sdaA)
   00270 Cysteine and methionine metabolism
    Rv0069c (sdaA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     Rv0069c (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha SDH_beta
Motif
Other DBs
NCBI-GeneID: 886986
NCBI-ProteinID: NP_214583
TubercuList: Rv0069c
UniProt: P9WGT5 C7FLQ4 A0A089S0Y8
Position
complement(76237..77622)
Genome map
AA seq 461 aa AA seqDB search
MTISVFDLFTIGIGPSSSHTVGPMRAANQFVVALRRRGHLDDLEAMRVDLFGSLAATGAG
HGTMSAILLGLEGCQPETITTEHKERRLAEIAASGVTRIGGVIPVPLTERDIDLHPDIVL
PTHPNGMTFTAAGPHGRVLATETYFSVGGGFIVTEQTSGNSGQHPCSVALPYVSAQELLD
ICDRLDVSISEAALRNETCCRTENEVRAALLHLRDVMVECEQRSIAREGLLPGGLRVRRR
AKVWYDRLNAEDPTRKPEFAEDWVNLVALAVNEENASGGRVVTAPTNGAAGIVPAVLHYA
IHYTSAGAGDPDDVTVRFLLTAGAIGSLFKERASISGAEVGCQGEVGSAAAMAAAGLAEI
LGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERNAISAGKAINAARMALRGDGIH
RVTLDQVIDTMRATGADMHTKYKETSAGGLAINVAVNIVEC
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcagcgtcttcgacctgttcaccatcggcatcgggccgtccagttcccacacc
gtgggaccgatgcgcgcggcaaaccagttcgtagttgcgctgcgccgccggggccacctg
gatgacctcgaggcgatgcgagtggatctgttcggctcgctcgcggccaccggagccggt
catggcaccatgtcggcgatattgctggggctggaaggctgccagccagaaacgattacc
accgaacacaaggaacgccggctcgccgagatcgcagcgtccggcgtgacgcgaatcggc
ggtgtcattccggtcccgctgaccgagcgtgatatcgacctgcatcccgacatcgttctg
ccaacgcatcccaacggaatgacgttcactgccgcgggcccacacggccgcgtcttggcc
accgagacttatttttcggtgggcggagggttcatcgtcacggaacagaccagcggcaac
agcggccaacatccatgctcagttgcccttccctacgtgtcggcccaagaactgctggac
atctgtgaccgcctcgacgtgtcaattagcgaagcggcgctgcgcaacgaaacatgttgc
cgcaccgagaacgaggtacgcgccgcgctgctgcacctgcgcgacgtcatggttgagtgc
gaacagcggagcatcgctcgcgaagggttgcttcctggcggcctccgggtgcgccggcga
gcgaaggtgtggtatgaccgcttgaacgccgaagaccccactcgcaagccggaattcgct
gaggactgggtcaacctggtcgcgctggcagtcaacgaggagaacgcctccggtgggcgc
gtcgtcaccgccccgaccaacggtgccgccggcatcgtgccggcggtcctgcactacgca
atccactacacgtcggccggcgcgggggaccccgacgatgtcaccgtgcgattcctgctc
actgctggagccatcggatcgttgttcaaggagcgagcatcgatctccggagccgaggtc
ggctgtcagggcgaggtcggctccgcggccgccatggccgccgccggattggctgaaatc
ctcggcggcacaccgcgacaagtggaaaacgccgccgagatcgccatggaacacagcctc
ggcctgacctgtgaccccatcgccgggctggtgcagatcccctgcatcgaacgcaacgcg
atttccgccggcaaggccatcaacgccgcacggatggcattgcgcggcgacggcatccat
cgcgtcaccctcgaccaggtcatcgacaccatgcgcgccaccggcgcggacatgcacacc
aagtacaaggaaacctcggccggcgggctcgccatcaacgtcgcagtcaacatcgtcgag
tgttga

DBGET integrated database retrieval system