KEGG   Mycobacterium tuberculosis H37Rv: Rv0098Help
Entry
Rv0098            CDS       T00015                                 

Gene name
fcoT
Definition
(RefSeq) fatty acyl CoA thioesterase FcoT
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FcoT
Motif
Other DBs
NCBI-GeneID: 886935
NCBI-ProteinID: NP_214612
TubercuList: Rv0098
UniProt: P9WM67 I6Y6W4
Structure
PDB: 

Position
107600..108151
Genome map
AA seq 183 aa AA seqDB search
MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQYSATEDSVLAYGNFT
IGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRGWSIDDYCQHQLSSMLI
RKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEFWDENGGAASGEIELAAL
NIP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaccgacttgacgccctgcacacgggtgctggcatccagcggcacggttccg
atcgcagaggaactgctggccagagtgctcgagccctactcctgcaaaggatgtcgctac
ctcatcgacgcacagtacagcgccaccgaggattcggttcttgcctatggcaacttcacg
atcggtgagtccgcctatattcgaagcacggggcacttcaacgcggtcgaactgattctg
tgtttcaatcagctcgcctacagcgccttcgctccggccgtcctcaacgaggaaatccgg
gtgcttcgcggctggtcgatcgacgactactgccaacaccagctctctagcatgctgatc
aggaaggcatcatcgcggttcagaaaaccgctgaacccgcaaaagttctctgcccgcctc
ctgtgtcgagatctgcaggtcatcgaacgaacctggcgctatctcaaggtcccgtgcgtc
atcgagttctgggacgagaacggcggggcggcgtccggtgagatcgaactagcggccctc
aacattccgtaa

DBGET integrated database retrieval system