KEGG   Mycobacterium tuberculosis H37Rv: Rv0189cHelp
Entry
Rv0189c           CDS       T00015                                 

Gene name
ilvD
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu00770  Pantothenate and CoA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mtu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv0189c (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv0189c (ilvD)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     Rv0189c (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-GeneID: 886774
NCBI-ProteinID: NP_214703
TubercuList: Rv0189c
UniProt: P9WKJ5 I6XUM9
Position
complement(219996..221723)
Genome map
AA seq 575 aa AA seqDB search
MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDEDFAKPQIGVASSWNE
ITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEGMHFSLVSREVIADSVE
VVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSILPGRAKLSDGSERDVTI
IDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANTMASAAEALGMSLPGSAAP
PATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHLLAI
AHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHIGGVPVVMKALLDAGLLHGDC
LTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGITILHGSLAPEGAVVKTAGFDSD
VFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPKGGPGMREMLAITGAIKGAGLGK
DVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRNGDRIRLDVAGRVLDVLADPAEFA
SRQQDFSPPPPRYTTGVLSKYVKLVSSAAVGAVCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaaccaccgacgaagccgcttccgtctcgacggtcgccgacatcaagccccgc
agtcgagacgtcaccgacggcctggagaaggccgctgcccggggcatgttgagggcggtg
ggcatggacgacgaagacttcgcgaagccacagatcggggtcgcgtcgtcgtggaacgaa
atcacgccgtgcaatctctcattggaccggctggccaacgcggtcaaggagggggtgttt
tcggccggcggctatccgcttgagttcggcacgatctcggtttcggacggcatctccatg
ggtcatgaggggatgcacttctcgctggtttcccgtgaggtgatcgccgacagcgtcgaa
gtcgtgatgcaggccgaacgactcgacggttcggtgctgctggccggatgcgacaaatcg
ctgcccggaatgctgatggccgccgcacgactggatctggcggcggtgttcctctacgcg
ggctctattttgcccggccgggccaagctctccgacggtagcgaacgagacgtcaccatc
attgacgccttcgaggcggtcggagcgtgctctcgcggtttgatgagtcgcgccgacgtc
gatgccatcgagcgggcaatctgccccggcgaaggggcatgcggcggcatgtacaccgct
aacaccatggccagcgccgccgaggcgctcggcatgtcgttgccgggcagcgcggcaccg
ccggcgaccgaccgccggcgcgacgggttcgcgcgtcgcagcggtcaggccgtcgtcgag
ctgctgcgccgcggcatcaccgcccgcgacatcctcaccaaggaggcgttcgagaacgcc
atcgcggtggtaatggcgttcggcggctcgaccaacgcggtgctgcatctgctggccatc
gcccacgaggccaacgtcgcactatcgcttcaggacttcagccggatcgggtcgggggtg
ccgcatttggccgatgtcaagccgttcggccgccatgtgatgtccgacgtcgatcacatc
ggcggtgtgccggtggttatgaaggcgctgctggacgccggtctgctacacggcgactgc
ctgacggttaccggtcacaccatggccgagaatctggctgccatcaccccgccggatcca
gatggcaaggtgctacgtgcgttggcaaacccgatccacccgagcggtggcatcaccatc
ctgcacggatcgctggcacccgaaggtgcggtggtcaagaccgccggattcgattccgac
gtattcgaaggcaccgcaagagttttcgacggcgagcgcgctgcgctggacgcccttgag
gatggcaccattaccgtgggcgacgccgtggtaatccggtacgaaggacccaagggcggc
cccgggatgcgcgaaatgctcgccatcacaggcgcgatcaaaggcgcaggactcggtaaa
gatgttctactgctgaccgacggccggttctccggtggaaccaccggcctgtgcgttggc
cacatcgcaccggaggcggtcgacggcggaccgatcgcacttctgcgcaacggcgaccgg
atccggctcgacgtggccggccgcgttctcgatgtgttggccgatccggccgaattcgcg
tcccgacaacaggatttcagtcctccaccgccgcgctacactactggcgtactgtccaag
tacgtcaagctggtcagctctgccgcggtcggcgcggtctgcggctag

DBGET integrated database retrieval system