KEGG   Mycobacterium tuberculosis H37Rv: Rv0211Help
Entry
Rv0211            CDS       T00015                                 

Gene name
pckA
Definition
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00020  Citrate cycle (TCA cycle)
mtu00620  Pyruvate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0211 (pckA)
   00020 Citrate cycle (TCA cycle)
    Rv0211 (pckA)
   00620 Pyruvate metabolism
    Rv0211 (pckA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     Rv0211 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_GTP PEPCK_N
Motif
Other DBs
NCBI-GeneID: 886744
NCBI-ProteinID: NP_214725
TubercuList: Rv0211
UniProt: P9WIH3 I6Y334
Structure
PDB: 

Position
251782..253602
Genome map
AA seq 606 aa AA seqDB search
MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRLCDQLVEAGTFIR
LNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMDPGEMRSIMKDLYRGCM
RGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRMGKAALEKMGDDGFFVKAL
HSVGAPLEPGQKDVAWPCSETKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMA
HDEGWLAEHMLILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGNTVFTNVALTDDGDVWWEGLE
GDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPILAPEWDDPQGVPISGILFGGR
RKTTVPLVTEARDWQHGVFIGATLGSEQTAAAEGKVGNVRRDPMAMLPFLGYNVGDYFQH
WINLGKHADESKLPKVFFVNWFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKAGGATTPI
GTVPAVEDLDLDGLDVDAADVAAALAVDADEWRQELPLIEEWLQFVGEKLPTGVKDEFDA
LKERLG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagcgaccatccccggtctggataccgcgccgacgaatcaccaggggttgctg
tcctgggtcgaagaggtcgccgagctcacccagccggaccgggtggtcttcactgacggc
tcggaagaagagttccagcggctctgcgatcagctagtcgaggccggcacgttcatcagg
ctcaaccccgagaagcacaagaactcctacctggcattgtcggatccgtccgatgtcgcg
cgggtggagtcgcggacgtacatctgctcggcgaaagagatcgacgccggccccaccaac
aactggatggatcccggcgaaatgcggtccatcatgaaagacctgtaccggggttgcatg
cgcgggcgcaccatgtatgtggtgccgttctgtatgggaccgctgggcgccgaggacccc
aaacttggtgtggagatcaccgactccgagtacgtcgtcgtctccatgcgcaccatgacc
cggatgggcaaggccgcgctggagaaaatgggcgacgacggtttctttgtcaaggcgctg
cactcggtcggcgcgccgctggaaccgggccaaaaggacgtggcctggccctgcagcgaa
accaagtacatcacccacttcccggagacccgggagatctggagctacggctcgggctac
ggcggcaacgcgttgctgggcaagaagtgctactcactgcgtatcgcgtcggcgatggcc
cacgatgagggctggctggccgagcacatgctgatcctcaagctgatttcgccggagaac
aaggcttactacttcgcggccgcattcccgtcggcgtgtggcaagaccaacctggcgatg
ctgcagccaaccatccccggctggcgtgcggagacactcggagacgacatcgcatggatg
cgatttggcaaggacggtcgcctgtacgccgtcaacccggaattcggcttcttcggggtg
gcgccgggcaccaactggaagtcgaaccctaacgccatgcgcaccattgccgccggcaac
acggtgttcaccaatgtcgcactcaccgacgacggcgacgtgtggtgggagggcctggaa
ggcgacccgcagcacctgatcgactggaagggcaacgactggtacttccgcgagacggaa
accaatgcggcacacccgaactcccggtactgcacaccgatgtcgcagtgcccgatcctg
gcccccgagtgggatgacccgcagggcgtcccgatctcggggatcctgttcggcggccgc
cgcaagaccacggttccgctggtcaccgaggcgcgcgactggcagcacggggtgttcatc
ggtgcgaccctgggtagcgagcagaccgccgcggccgagggcaaggtcggcaatgtgcgc
cgcgacccgatggccatgctgccgtttttgggctacaacgttggggactacttccagcac
tggatcaacctgggcaagcacgccgatgagtccaagctgcccaaggtgttcttcgtcaac
tggttccgtcgcggtgacgacggtcgcttcctgtggccgggcttcggcgagaacagccgg
gtgctgaagtggatcgtcgatcgcatcgagcacaaggccggcggtgcgaccaccccgatc
ggcaccgttcccgccgtggaggacttggacctggacggactggacgtcgacgccgccgat
gtagccgcggcgctggcagtcgatgccgatgaatggcgtcaggaactgccgctgatcgaa
gaatggctgcagttcgtcggcgagaagctgccgaccggtgtcaaagatgagttcgacgcc
ctgaaggagcgcctaggttag

DBGET integrated database retrieval system