KEGG   Mycobacterium tuberculosis H37Rv: Rv0217cHelp
Entry
Rv0217c           CDS       T00015                                 

Gene name
lipW
Definition
(RefSeq) esterase LipW
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 COesterase AXE1 Peptidase_S9 DLH Esterase_phd BAAT_C
Motif
Other DBs
NCBI-GeneID: 886726
NCBI-ProteinID: NP_214731
TubercuList: Rv0217c
UniProt: A0A089QKY9 P96399
Position
complement(259923..260831)
Genome map
AA seq 302 aa AA seqDB search
MSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTPPDIEVLTLESGVGVR
LYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSRLGITVASVDYRLAPENPYPA
ALGDCYSALTWLASLPAVDPARVAIGGASAGGGLAAALALLARDRGGITPAFQLLVYPML
DDRPSIAPANPHYRLWNGRANRFGWRAYLGDADARVAVPGRRDDLGGLAPAWIGVGTHDL
LHDEDLAYAERLTAAGVPCQVEVVEGAFHGFDRVAPNVGVSQRFFTSQCNSLRAALALSN
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggcaacgaagtccaccccgacctgcgtcgcatcgccgtcgtcaccccacgacag
ctggtcggtcctcgcaccctgccagtcatgcgggcattgatcgtcgtcgcggggcttcga
atgtcccgtacaccccccgatatcgaggtgctcaccctggaatccggggtcggtgtccgg
ctataccgacccgccggcagcaacgaaccagcgcccgcgctgctgtggatccacgccggc
ggatacgtaatgggcaccgcgcaacaggacgatcggctctgcctccggttcagcagcaga
ctgggcatcactgtcgcatcggtggactaccgcctggcgccggaaaatccgtatcctgcc
gccctgggcgactgctactcggcgttgacctggctggccagcctgccggcggtggacccc
gcgcgggtggcaatcggcggcgctagtgccggcggcggcctcgcggcggcgctggctctg
cttgcccgcgaccgtggcggcatcacaccggcatttcagttgctggtgtaccccatgctc
gacgaccggccgtcgatcgcccccgccaacccgcactaccggctatggaacgggcgcgcc
aaccggttcggctggcgggcatatcttggcgatgcggacgcacgggtcgcggtcccggga
cggcgtgacgacctaggagggctggcgccggcatggatcggcgtcggcacccacgacctg
ctccacgacgaggatctggcctatgccgaacgtctgacagcagccggggtgccatgccag
gtagaagtagtcgaaggcgccttccacggtttcgatcgtgtggccccgaatgttggggtc
tcacaaaggttcttcactagtcagtgcaacagtttgcgtgccgcgctggcccttagtaac
cgaacctag

DBGET integrated database retrieval system