KEGG   Mycobacterium tuberculosis H37Rv: Rv0357cHelp
Entry
Rv0357c           CDS       T00015                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00250  Alanine, aspartate and glutamate metabolism
mtu01100  Metabolic pathways
Module
mtu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0357c (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv0357c (purA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Rv0357c (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 886484
NCBI-ProteinID: NP_214871
TubercuList: Rv0357c
UniProt: P9WHN3 I6Y3K7
Position
complement(435471..436769)
Genome map
AA seq 432 aa AA seqDB search
MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGENFALHLIPSGV
LTPGVTNVIGNGVVIDPGVLLNELRGLQDRGVDTAKLLISADAHLLMPYHIAIDKVTERY
MGSKKIGTTGRGIGPCYQDKIARIGIRVADVLDPEQLTHKVEAACEFKNQVLVKIYNRKA
LDPAQVVDALLEQAEGFKHRIADTRLLLNAALEAGETVLLEGSQGTLLDVDHGTYPYVTS
SNPTAGGAAVGSGIGPTRIGTVLGILKAYTTRVGSGPFPTELFDEHGEYLSKTGREFGVT
TGRRRRCGWFDAVIARYAARVNGITDYFLTKLDVLSSLESVPVCVGYEIDGRRTRDMPMT
QRDLCRAKPVYEELPGWWEDISGAREFDDLPAKARDYVLRLEQLAGAPVSCIGVGPGREQ
TIVRRDVLQDRP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgatcgtcctcatcggcgcccaatggggcgacgagggcaagggtaaggccacc
gacctgttgggtggccgcgtgcagtgggtggtgcgctatcaggggggcaacaacgccggg
cacaccgtcgtcttgcctaccggcgagaatttcgcattgcatctcatcccgtcgggtgtg
ctgacgcccggggtcaccaacgttatcggcaacggcgtggtgatcgatcccggtgtcctg
ctcaatgagctgcggggactgcaagaccgcggcgtggacaccgccaagctgttgatctcc
gccgacgcccatctgctgatgccttaccacattgctatcgacaaggtcaccgagcgctat
atgggcagcaagaagatcggcaccaccggccgtggtatcgggccgtgctaccaggacaag
atcgcccgtattgggatccgggtcgccgatgtgctggacccggaacaattgacccacaag
gtcgaggccgcgtgcgagttcaagaaccaagtgctggtcaagatctacaaccgcaaggcc
ctggaccccgcgcaggtggtcgacgcgctgctggagcaggccgagggtttcaagcatcgc
atcgccgacacccggctgctactcaatgctgccctggaggccggcgaaacggtgctgctg
gaaggctctcaaggcaccctgctcgatgtcgaccacggcacctacccgtatgtgacatcg
tcgaatccgacggcgggtggcgcggccgtgggctctggtatcggcccgacccgcatcggc
accgtgctggggattctcaaggcctacaccactcgggtgggctccggcccgttccccacc
gagctgttcgacgaacacggcgaatacctgtccaagactggccgcgagttcggtgtgacc
accggccggcgccggcgctgcggctggttcgacgccgtcattgcccgctacgccgcccgg
gtcaacggcatcaccgactacttcctgaccaagctcgacgtgctgtccagcctggaatcg
gtgccggtctgcgtcggatatgagatcgacggccggcgcacccgcgatatgccgatgacc
cagcgggatctttgccgcgccaagccggtttacgaggagctgccgggctggtgggaagac
atctccggggcgcgcgagttcgacgacctgcccgccaaagcgcgtgattatgtgctgcga
ctggaacagcttgccggagcaccggtttcgtgcattggagtcggtccggggcgggaacag
accatcgtgcgccgggacgtcctgcaggatcgcccgtga

DBGET integrated database retrieval system