KEGG   Mycobacterium tuberculosis H37Rv: Rv0408Help
Entry
Rv0408            CDS       T00015                                 

Gene name
pta
Definition
(RefSeq) phosphate acetyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00430  Taurine and hypotaurine metabolism
mtu00620  Pyruvate metabolism
mtu00640  Propanoate metabolism
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01200  Carbon metabolism
Module
mtu_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv0408 (pta)
   00640 Propanoate metabolism
    Rv0408 (pta)
  09102 Energy metabolism
   00680 Methane metabolism
    Rv0408 (pta)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Rv0408 (pta)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Rv0408 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB DRTGG AAA_26
Motif
Other DBs
NCBI-GeneID: 886401
NCBI-ProteinID: NP_214922
TubercuList: Rv0408
UniProt: P9WHP1 I6XV72
Position
491786..493858
Genome map
AA seq 690 aa AA seqDB search
MADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRLSAERDYILELLLAHT
SAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECDAVVVVGSDYTDVTSPTELSV
NGRIAVNLGAPVLLTVRAKDRTPDQVASVVEVCLAELDTQRAHTAAVVANRCELSAIPAV
TDALRRFTPPSYVVPEEPLLSAPTVAELTQAVNGAVVSGDVALREREVMGVLAAGMTADH
VLERLTDGMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVLNGGFQLHPAIAALVSGLRL
RLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELMDRHVDVAGLLAQLTIPIPTV
TTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLLQRGIVDLTILGDEAKVRLRAA
ELGVDLDGATVIEPCASELHDQFADQYAQLRKAKGITVEHAREIMNDATYFGTMLVHNCH
ADGMVSGAAHTTAHTVRPALEIIKTVPGISTVSSIFLMCLPDRVLAYGDCAIIPNPTVEQ
LADIAICSARTAAQFGIEPRVAMLSYSTGDSGKGADVDKVRAATELVRAREPQLPVEGPI
QYDAAVEPSVAATKLRDSPVAGRATVLIFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLRK
PVNDLSRGALVDDIVNTVAITAIQAQGVHE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
ttggctgactcctcggcgatctacctcgccgcaccagaatcgcagacgggtaagtcgacg
attgcactggggcttttgcaccgactgaccgcgatggtcgccaaagtcggtgtgttccgg
ccgattacgcggctctctgcggagcgggactacatcctggaactactgctcgcgcacacc
agtgcgggcctgccctatgagcggtgtgttggcgtgacctaccagcagctgcatgctgac
cgcgacgacgcgatcgccgaaattgtcgattcgtatcacgcaatggccgacgagtgtgac
gcggtggtggtcgtcggcagtgactacaccgacgtcaccagccccaccgagctctcggtc
aacggccggatcgcggtgaacctcggcgcgccagtgttgttgacggttcgggcgaaggac
cgcacccccgatcaggtcgccagcgtcgtcgaggtctgcttggccgagctggacacccag
cgcgctcataccgcggcggtagtggcgaaccggtgcgagctgtccgcgataccggccgtg
accgacgcgctgcgcaggttcaccccgcctagctatgtagtgcccgaggaaccactgctg
tcggcgccgaccgttgccgagttaacgcaggctgtgaacggggcggtggtaagcggtgat
gttgcgctgcgcgaacgtgaggtgatgggcgtgctggccgcgggtatgaccgccgaccat
gtgttggagcggctgaccgatggcatggcggtgattactcccggcgaccgctcggacgtg
gtgttggccgtcgctagcgcccatgcggccgaagggtttccgtcattgtcatgcatcgtc
ctcaatggcgggttccagttgcatccggcgatcgccgccctggtttccggcctgcgattg
cggttacctgtcatcgccaccgcgttgggcacctacgacaccgccagcgctgccgcgtcg
gcccgcgggctggtaacggcgacgtcgcaacgcaagatcgacaccgcgttggagctgatg
gaccgccacgtggacgtcgccggtctattggcgcagctgaccattcccatccctacggtc
actacaccacagatgttcacttatcggctgctgcagcaggcccgttcggacctcatgcgc
atcgtccttcccgaaggggacgacgatcgcatcctcaaatcggcgggccgcctgcttcag
cgcggcatcgtcgacctgaccatcctgggcgatgaagccaaagtccgtctgcgggcagcg
gaactcggtgtggacctggacggcgccacggtaatcgagccatgcgcaagcgaactgcac
gatcaattcgccgaccagtatgcgcagttgcgtaaggcgaagggaatcaccgtggagcat
gcccgcgaaatcatgaacgatgccacatatttcggcaccatgctggtgcacaactgtcat
gccgacggcatggtatcgggtgctgctcacaccacggcgcacaccgttcgtccggcgctg
gagatcatcaagaccgttccgggcatatccaccgtgtccagcattttcctgatgtgtctg
ccggatcgggtactggcgtacggcgactgcgcgatcatcccgaacccgacggtggagcag
ctcgctgatatcgccatctgctcggcacgcaccgccgcacagttcggcatcgagccccgg
gtggccatgctgtcctactccaccggtgactcggggaaaggtgccgacgtcgacaaggtc
agagcggcaacggagttggtgcgcgctcgggagccgcagctgccggtcgagggtcccatt
caatacgacgccgcagtggaaccgtcggtcgcggccaccaagttgcgcgattcgccggtg
gccggccgcgcgacggtgctgatcttccccgatctcaataccggcaacaacacctacaaa
gcggtgcagcgttctgcgggtgcgatcgcgatcggcccggtgctgcagggcttacgcaag
ccggtgaacgacctatctcggggtgcactggtcgacgacatagtcaacaccgtggccatc
acggcgattcaggcgcagggcgtccatgagtag

DBGET integrated database retrieval system