KEGG   Mycobacterium tuberculosis H37Rv: Rv0411cHelp
Entry
Rv0411c           CDS       T00015                                 

Gene name
glnH
Definition
(RefSeq) glutamine-binding lipoprotein GlnH
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv0411c (glnH)
Transporters [BR:mtu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Rv0411c (glnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1
Motif
Other DBs
NCBI-GeneID: 886393
NCBI-ProteinID: NP_214925
TubercuList: Rv0411c
UniProt: P96257 L0T6K9
Structure
PDB: 

Position
complement(497314..498300)
Genome map
AA seq 328 aa AA seqDB search
MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTPVGMEIMPPQPPLPPD
SSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFDV
DIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYL
DANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAPPPVIVSVVNWADCLVALQ
QREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRN
DGTWNTLYRKWLTVLGPAPAPPTPRYVD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgccgggccctcctggcgcgggcggcagccccactcgcgccgctggccttggcg
atggtgctggccagttgcggccactcggaaacgctgggggtggaggcgacgccgacgctg
ccgctgcccacaccggtcggcatggagatcatgccaccgcaacccccgctgccgccggac
agttcgagccaggactgcgatcccaccgccagcctgcgcccctttgccaccaaggccgag
gccgacgccgcggtggccgacatccgcgcgcgcggcaggctgatcgtcggactcgacatc
ggcagcaacctgttcagcttccgcgacccgatcaccggcgagatcaccggcttcgacgtt
gacatcgccggcgaagtggcacgcgacatcttcggtgtcccgtcacatgtcgagtaccgg
atcctgtcggccgcggagcgggtcaccgcgctgcagaagtcgcaggtcgacatcgtcgtc
aagacgatgtcgatcacctgcgagcggcgcaagctggtcaacttctccaccgtctacctc
gacgccaaccaacgcatcctcgccccgcgtgactcgccgatcacaaaggtgtccgacctg
tcgggcaagcgggtctgtgtggccaggggcaccacatcgttgcgccgtatccgggagatc
gcaccgcctcccgtcattgtgtcggtggtgaactgggcggactgcttggtggccttgcag
cagcgcgagatcgacgctgtcagcaccgacgacaccatcctggccgggctggtagaggaa
gacccctacctgcatatcgtcgggcccgacatggccgaccagccctacggcgtcgggatc
aacctggacaacaccggattggtccggttcgtcaacggcacgctcgaacgcatccgcaat
gacggcacctggaacacgttgtatcgcaagtggctgacggtgctcggcccagcccccgcc
ccgcccacgccgaggtatgtggactga

DBGET integrated database retrieval system