KEGG   Mycobacterium tuberculosis H37Rv: Rv0437cHelp
Entry
Rv0437c           CDS       T00015                                 

Gene name
psd
Definition
(RefSeq) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00564  Glycerophospholipid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Module
mtu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rv0437c (psd)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Rv0437c (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131
Motif
Other DBs
NCBI-GeneID: 886350
NCBI-ProteinID: NP_214951
TubercuList: Rv0437c
UniProt: P9WHQ5 I6Y3S2
Position
complement(525387..526082)
Genome map
AA seq 231 aa AA seqDB search
MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRYRWLRGTGLLAAAACA
GFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPLPRVSIFLSILDAHVQR
APVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAEVVAVQIAGLVARRIVCD
AHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVAGETVLAECR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggccagacgcccccgccccgacggcccgcaacatctgctcgccctggtgcggtccgcc
gttccaccggttcatccggccgggcggccgttcattgccgccggccttgcgattgcggcc
gtcggacaccgctaccggtggttgcgcggcacgggtctgctggcggccgctgcctgcgcg
ggcttcttccggcacccgcagcgggtaccgcccaccaggccggctgccattgtcgcgccc
gccgacggcgtgatctgcgcgatcgactcagcggccccaccggccgaactcagcatgggt
gacacgccgttaccgcgagtcagcatcttcctgtcgatattggacgcccacgtgcaacgt
gccccggtgagcggggaagtgatcgccgtgcaacaccggccgggccggttcgggtcggcc
gacctaccggaggcgagcgacgacaacgagcgcaccagtgtgcggatccgcatgcccaac
ggcgccgaggtggtcgcggtgcagatcgccgggctggtggcgcgccgcattgtgtgcgac
gcacacgtcggagacaagctggccatcggtgacacctacggcctgatccggttcggctcc
cggctggatacctacctgccagcgggcgcagagccgatcgtcaacgtcggccagcgcgcg
gtcgccggcgagaccgtgctggccgaatgtcgatga

DBGET integrated database retrieval system