KEGG   Mycobacterium tuberculosis H37Rv: Rv0462Help
Entry
Rv0462            CDS       T00015                                 

Gene name
lpdC
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00020  Citrate cycle (TCA cycle)
mtu00260  Glycine, serine and threonine metabolism
mtu00280  Valine, leucine and isoleucine degradation
mtu00620  Pyruvate metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00640  Propanoate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0462 (lpdC)
   00020 Citrate cycle (TCA cycle)
    Rv0462 (lpdC)
   00620 Pyruvate metabolism
    Rv0462 (lpdC)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv0462 (lpdC)
   00640 Propanoate metabolism
    Rv0462 (lpdC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv0462 (lpdC)
   00280 Valine, leucine and isoleucine degradation
    Rv0462 (lpdC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Rv0462 (lpdC)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rv0462 (lpdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_3 FAD_binding_2 NAD_binding_8 HI0933_like Thi4 3HCDH_N ApbA DAO
Motif
Other DBs
NCBI-GeneID: 886300
NCBI-ProteinID: NP_214976
TubercuList: Rv0462
UniProt: P9WHH9 I6Y7V9
Structure
PDB: 

Position
552614..554008
Genome map
AA seq 464 aa AA seqDB search
MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVH
IFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANT
LLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEEQILSRELPKSIIIAGAG
AIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTN
VGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGL
TEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELL
PELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgacccactatgacgtcgtcgttctcggagccggtcccggcgggtatgtcgcggcgatt
cgcgccgcacagctcggcctgagcactgcaatcgtcgaacccaagtactggggcggagta
tgcctcaatgtcggctgtatcccatccaaggcgctgttgcgcaacgccgaactggtccac
atcttcaccaaggacgccaaagcatttggcatcagcggcgaggtgaccttcgactacggc
atcgcctatgaccgcagccgaaaggtagccgagggcagggtggccggtgtgcacttcctg
atgaagaagaacaagatcaccgagatccacgggtacggcacatttgccgacgccaacacg
ttgttggttgatctcaacgacggcggtacagaatcggtcacgttcgacaacgccatcatc
gcgaccggcagtagcacccggctggttcccggcacctcactgtcggccaacgtagtcacc
tacgaggaacagatcctgtcccgagagctgccgaaatcgatcattattgccggagctggt
gccattggcatggagttcggctacgtgctgaagaactacggcgttgacgtgaccatcgtg
gaattccttccgcgggcgctgcccaacgaggacgccgatgtgtccaaggagatcgagaag
cagttcaaaaagctgggtgtcacgatcctgaccgccacgaaggtcgagtccatcgccgat
ggcgggtcgcaggtcaccgtgaccgtcaccaaggacggcgtggcgcaagagcttaaggcg
gaaaaggtgttgcaggccatcggatttgcgcccaacgtcgaagggtacgggctggacaag
gcaggcgtcgcgctgaccgaccgcaaggctatcggtgtcgacgactacatgcgtaccaac
gtgggccacatctacgctatcggcgatgtcaatggattactgcagctggcgcacgtcgcc
gaggcacaaggcgtggtagccgccgaaaccattgccggtgcagagactttgacgctgggc
gaccatcggatgttgccgcgcgcgacgttctgtcagccaaacgttgccagcttcgggctc
accgagcagcaagcccgcaacgaaggttacgacgtggtggtggccaagttcccgttcacg
gccaacgccaaggcgcacggcgtgggtgaccccagtgggttcgtcaagctggtggccgac
gccaagcacggcgagctactgggtgggcacctggtcggccacgacgtggccgagctgctg
ccggagctcacgctggcgcagaggtgggacctgaccgccagcgagctggctcgcaacgtc
cacacccacccaacgatgtctgaggcgctgcaggagtgcttccacggcctggttggccac
atgatcaatttctga

DBGET integrated database retrieval system