KEGG   Mycobacterium tuberculosis H37Rv: Rv0467Help
Entry
Rv0467            CDS       T00015                                 

Gene name
icl1
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01200  Carbon metabolism
Module
mtu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv0467 (icl1)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rv0467 (icl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-GeneID: 886291
NCBI-ProteinID: YP_177728
TubercuList: Rv0467
UniProt: P9WKK7 I6Y7W3
Structure
PDB: 

Position
557527..558813
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL
HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgtcggcaccccgaagagcgcggagcagatccagcaggaatgggacacgaac
ccgcgctggaaggacgtcacccgcacctactccgccgaggacgtcgtcgccctccagggc
agcgtggtcgaggagcacacgctggcccgccgcggtgcggaggtgctgtgggagcagctg
cacgacctcgagtgggtcaacgcgctgggcgcgctgaccggcaacatggccgtccagcag
gtgcgcgccggcctgaaggccatctacctgtcgggctggcaggtcgccggcgatgccaac
ctgtccgggcacacctaccccgaccagagcctgtatcccgccaactcggtgccgcaggtg
gtccgccggatcaacaacgcactgcagcgcgccgaccagatcgccaagatcgagggcgat
acttcggtggagaactggctggcgccgattgtcgccgacggcgaggccggctttggcggc
gcgctcaacgtctacgagctgcagaaagccctgatcgccgcgggcgttgcgggttcgcac
tgggaggaccagttggcctctgagaagaagtgcggccacctgggcggcaaggtgttgatc
ccgacccagcagcacatccgcactttgacgtctgctcggctcgcggccgatgtggctgat
gttcccacggtggtgatcgcccgtaccgacgccgaggcggccacgctgatcacctccgac
gtcgacgagcgcgaccagccgttcatcaccggcgagcgcacccgggaaggcttctaccgc
accaagaacggcatcgagccttgcatcgctcgggcgaaggcctacgccccgttcgccgac
ttgatctggatggagaccggtaccccggacctcgaggccgcccggcagttctccgaggcg
gtcaaggcggagtacccggaccagatgctggcctacaactgctcgccatcgttcaactgg
aaaaagcacctcgacgacgccaccatcgccaagttccagaaggagctggcagccatgggc
ttcaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttcgat
ctggcctacggctacgcccagaaccagatgagcgcgtatgtcgaactgcaggaacgcgag
ttcgccgccgaagaacggggctacaccgcgaccaagcaccagcgcgaggtcggcgccggc
tacttcgaccggattgccaccaccgtggacccgaattcgtcgaccaccgcgttgaccggt
tccaccgaagagggccagttccactag

DBGET integrated database retrieval system